KEGG   Sinorhizobium medicae: Smed_4478Help
Entry
Smed_4478         CDS       T00555                                 

Definition
(RefSeq) dihydroxy-acid dehydratase
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-GeneID: 5318343
NCBI-ProteinID: YP_001313211
UniProt: A6UHZ8
Position
pSMED01:960818..962563
Genome map
AA seq 581 aa AA seqDB search
MKKKAEWPRKLRSQDWFGGTGKNAIMHRSWMKNQGLPADTFDGRPIIGICNTWSELTPCN
AHLRDLAERVKRGVYEAGGFPVEFPVFSTGESTLRPTAMMFRNLAAMDVEESIRGNPIDG
VVLLGGCDKTTPSLLMGAASVDIPAIVVSGGPMLNGKWRGKDVGSGTAIWQFSEMVKSGE
MTLEEFMDAEQGMARSAGSCMTMGTASTMASMAEALGMTLSGNAAIPAVDARRRVISQLT
GRRIVEMVKEDLKPSDILTKEAFENAIRVNGAVGGSTNAVLHLLALAGRVGVDLSLDDWD
RLGRDVPTIVNLQPSGKYLMEEFYYAGGLPVVIKAVAEMGLLHNDAITVSGDTIWNDVKG
VVNYNDDVILPRERALTKSGGIAVLRGNLAPRGAVLKPSAASPNLMQHKGRAVVFESIED
YHARINREDLDIDETCIMVLKYCGPKGYPGMAEVGNMGLPPKVLKKGVTDMIRISDARMS
GTAYGTVILHTAPEAAEGGPLALVENGDLIEVDIPNRTLHLHVSDEELARRRAAWVSPVK
PLSGGYGSLYMKTVMQADAGADLDFLVGPRGDRIPMDRDSH
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaagctgagtggccgcgcaagctccgttcgcaggattggttcggcggtact
ggcaagaatgccatcatgcatcgctcctggatgaaaaatcaggggcttcccgctgacact
tttgacgggcggccgatcatcggcatctgcaatacctggtccgagctcacgccgtgcaac
gcgcatcttcgcgaccttgcagagcgcgtgaagcgcggggtctacgaggcggggggcttc
ccggtggaattccccgtcttttcgaccggggaaagcacacttcgcccgacggcgatgatg
ttccgcaacctcgcggccatggatgtcgaggaatcgattcgcggcaatccgatcgacggc
gtcgtgctgctcggcggctgcgacaagacgacccccagcctcctgatgggagcggccagc
gtcgacattccggcgatcgtcgtttccggcggtcccatgctcaacggaaagtggcgcggc
aaggatgtcggttcgggcaccgcgatctggcaattctcggaaatggtcaaatccggtgag
atgacgctggaggagttcatggacgccgagcagggcatggcccgttccgcgggaagctgt
atgaccatgggtacggcctcgaccatggcgtcgatggccgaagcgctcggcatgaccctt
tcgggcaacgccgccattccggcggtggatgcgcgccgtcgggttatttcgcagcttacc
ggacgccgcatcgtcgagatggtcaaggaggatctgaagccctccgacatactgaccaag
gaggcattcgagaacgctatccgcgtcaacggcgccgtcggcggctccaccaatgcggtg
ctgcatcttctcgcgctggcaggtcgcgtcggcgttgatctatcgctcgacgactgggac
aggctcggccgcgacgtgcccaccatcgtcaacctccagccctccggcaagtatctgatg
gaggaattctattatgccggcggcctgccggtcgtgatcaaggcggtcgcggagatgggc
ctgctgcacaatgatgccatcaccgtcagcggcgacacgatctggaacgacgtcaagggc
gtggtcaactacaacgacgacgtgatcctgccgcgggaaagggcgctcacgaaatcgggt
ggtatcgcagtgctgcgcggcaatctcgcgccgcgcggcgccgtcctgaagccatcagct
gcctcgccgaacctgatgcagcacaagggccgcgcggtcgttttcgagagcatcgaggat
tatcacgcacgcatcaaccgtgaggacctcgacatcgacgagacctgcatcatggtgctg
aaatattgcggtcccaaaggctatcccggcatggccgaggtcggcaatatgggtctgccg
cccaaggttctgaaaaagggagtgacggacatgatccgcatttcggatgcgcgtatgtcg
ggcacggcctacggtacggtcatactccataccgcgccggaagcggcggaaggcggtccc
ttggcgctcgtggagaacggcgatctgatcgaggtcgacatcccgaaccgcacgctgcat
ctccatgtttccgacgaggaacttgcgcgtcgccgcgcggcctgggtgtcgccggtcaag
ccgctgagcggcggctatggcagcctctatatgaagacggtcatgcaggccgacgccggc
gccgatctggacttccttgtcggcccacgtggcgatcgcattccgatggatcgagacagc
cattga

DBGET integrated database retrieval system