KEGG   Sinorhizobium medicae: Smed_4480Help
Entry
Smed_4480         CDS       T00555                                 

Definition
(RefSeq) transglutaminase domain-containing protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transglut_core Bact_transglu_N DUF553 Transglut_core3 Thymidylate_kin
Motif
Other DBs
NCBI-GeneID: 5318345
NCBI-ProteinID: YP_001313213
UniProt: A6UI00
Position
pSMED01:complement(963611..964429)
Genome map
AA seq 272 aa AA seqDB search
MHLKISHTTEYRYDAPVQYALQRLRLTPVNLPGQTVLNWKTLVDGAAIEVSYDDQFGNRT
HLVSVDADRTVLRIEAQGEVETEDRAGVFGLHHSFAPLWLYVRETPLSKPGKRVRELAKA
AVGSSELERMHSLMALVHAAVRYEPGETQVGTTAEEALERGKGVCQDHAHVLISAARTLG
LPARYVSGYLMMEDRTEQTASHAWADIHIAGLGWVGFDAANKVCPDDRYVRIASGLCYRD
AAPVSGLVHGFGAETLKVALTVEKQAQRQVQC
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgaaaatcagccatacgaccgagtatcgctacgacgcaccggtacaatacgcg
ctgcagcgcctgcgtctcacgccggtaaatctgcctggtcaaaccgtcctcaactggaag
acgctggtggacggcgccgcgatcgaagtgagctacgacgaccagtttggcaaccgcacg
catcttgtcagcgtcgacgccgatcgaactgtccttcgcatagaagcgcagggcgaagtc
gagacggaagaccgggccggcgttttcggcctgcaccattcgttcgcgcctctgtggctt
tatgtccgcgaaaccccgctcagcaagcccggcaagcgcgtccgcgagcttgcgaaggcg
gcggttggcagcagcgagctcgaacgcatgcattccctgatggcacttgtccatgctgcg
gtcagatatgagccgggcgagacgcaggtcgggaccacggcggaagaagccctggagcgt
ggcaagggcgtatgtcaggaccatgcccatgttctgatctcagccgcccgcacgctgggg
ctgccggctcgttacgtctccggctatctaatgatggaggaccgtacggagcagacggca
agtcacgcctgggccgacatacacattgccggcctcggatgggtcggcttcgatgccgcc
aacaaggtctgcccggacgaccgctatgtccgcatcgcctcgggcctctgctatcgcgac
gcagcgccggtctcggggctggtgcacggtttcggcgcggagacactgaaggtggccctt
accgtcgaaaagcaggcgcagcgccaggttcaatgttag

DBGET integrated database retrieval system