KEGG   Sinorhizobium medicae: Smed_4484Help
Entry
Smed_4484         CDS       T00555                                 

Definition
(RefSeq) DEAD/DEAH box helicase
  KO
K11927  ATP-dependent RNA helicase RhlE [EC:3.6.4.13]
Organism
smd  Sinorhizobium medicae
Pathway
smd03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:smd00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Smed_4484
Enzymes [BR:smd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Smed_4484
Messenger RNA biogenesis [BR:smd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     Smed_4484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII Helicase_RecD AAA_19
Motif
Other DBs
NCBI-GeneID: 5318349
NCBI-ProteinID: YP_001313217
UniProt: A6UI04
Position
pSMED01:complement(968351..969847)
Genome map
AA seq 498 aa AA seqDB search
MSTFKELGLSQEILATLTANGFEKPTPIQTQAIPLVLQGRDLIGLAQTGTGKTAAFGLPM
IEKLQADGKRPDPRNIRALILAPTRELVNQIATNLKLFVKKTPIKVGVVVGGVSINKQTE
QLARGVDILVATPGRLLDLISRKAVTLTQGRYLVLDEADQMLDLGFIHDLRKIAKLVPKN
RQTLLFSATMPKLIAELAGEYLTDPVKVEVTRPGKAADKVEQYVHFVPGKDLKTTILKQT
LTANPDGLSLVFSRTKHGAEKLMKHLDQVGFKAASIHGNKSQGQRERALKAFRDGEIRVL
VATDVAARGIDIPGVTHVYNYDLPEVADAYVHRIGRTARNGRDGIAIAFCAPDEIRLLRD
IEKLMGIEIAVASGEVPADQARPSKGRGGRGNAQSRGNGAGQRQGGPRRDRPQRQSAAGG
FAGDELLRDDRSQQHERRDHRAPGQDGRPEGNRNHEAKKHHGRPGPKRDGRRGNEGQPSN
RNEGARGMRRAENRAPRG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttgtccacatttaaagagctcggcctctcgcaggagatcctggcgacactgaccgccaac
ggtttcgagaagccgacgcccatccagacccaggccattccgcttgtcctccaaggccgc
gatctcatcggcctcgcccagacgggcacgggcaaaacggccgcctttggcctgccgatg
atcgaaaagcttcaggccgacggcaaacgccccgatccgcgcaacatccgtgccctcatc
cttgcgccgacccgagagctcgtcaaccagatcgccaccaatcttaaactcttcgtgaag
aagacaccgattaaagtcggagtcgtggtaggcggcgtgtcgatcaacaagcagaccgaa
cagctggcgcgcggcgtcgatattctcgtcgcaacgcccggccgtctgctggatctcatc
tcccgcaaggctgtgaccctcacccagggacgctacctcgtcctggacgaggccgaccag
atgctcgacctcggctttattcacgacctgcgcaagatcgcgaagctcgttccgaagaat
cgtcagacgctgctcttctccgcgaccatgccgaagctgatcgccgagcttgccggcgaa
tatctcaccgatccggtcaaggtcgaggtcacgcggcccggcaaggcggccgacaaggtc
gagcaatatgtccacttcgttccgggcaaggacctgaagacgacaatcctcaaacagacg
ctgaccgcaaatccggacggattgtcgctggtcttcagccgcaccaagcatggcgccgaa
aagctgatgaagcatctggaccaggtcggtttcaaggccgcctcgatccacggcaacaag
agccagggccagcgagagcgcgctctgaaagccttccgcgatggtgaaatccgtgtactc
gtggcgaccgatgtcgccgcacgcggcattgacattcccggcgtgacgcatgtctacaac
tacgacctgccggaggtggccgacgcttatgtccaccgtatcggccgcacggcccgaaac
ggccgcgacggtattgcgatcgccttttgcgccccggacgaaatccggctgctgcgcgat
attgaaaagctgatgggcatcgagattgccgtcgccagcggagaagttccggccgaccag
gcccgcccgtccaagggacgcggcggtcgcggcaacgcccagtcccgcggcaatggcgca
ggacagcgccagggcggacctcgccgggatcggccacaacgccagtcggcagccggcggc
ttcgccggcgacgaactgttgcgcgacgaccgttcgcaacagcacgagcgccgcgatcat
cgtgctccgggccaggacggtcgtccggaaggcaaccgcaaccacgaagccaagaagcac
catggccgtccgggcccgaagcgtgacggccggcgcggcaatgaaggccagcccagcaac
cgcaatgaaggcgcccggggcatgcgccgcgcggaaaatcgcgcgccgcgagggtaa

DBGET integrated database retrieval system