KEGG   Sinorhizobium medicae: Smed_4491Help
Entry
Smed_4491         CDS       T00555                                 

Definition
(RefSeq) ureidoglycolate hydrolase
  KO
K01483  ureidoglycolate lyase [EC:4.3.2.3]
Organism
smd  Sinorhizobium medicae
Pathway
smd00230  Purine metabolism
smd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Smed_4491
Enzymes [BR:smd01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.3  ureidoglycolate lyase
     Smed_4491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ureidogly_lyase
Motif
Other DBs
NCBI-GeneID: 5319183
NCBI-ProteinID: YP_001313224
UniProt: A6UI11
Position
pSMED01:975501..976007
Genome map
AA seq 168 aa AA seqDB search
MSHLLSIEPLTREAFAPFGSIMEADPASMRFINGGNTERFHALARVDAAGEGAGAIINIF
RGQPRVFPYSVTMMERHPLGSQSFSPLQDRPWLVVVAEDEGGRPGRPRVFLANGRQGVNY
ARNIWHHPLMSVGVASDFIVVDREGPGSNLEEFYYDEAFVIRDPFEGG
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatttgctttcgatcgagcccctcacgagggaggctttcgcaccgttcggcagt
atcatggaggcggaccccgcctccatgcgctttatcaatggcggcaataccgagcgattt
cacgcactggcgcgcgtcgatgcggcgggtgagggcgccggtgcaatcatcaacatcttt
cgcgggcaaccccgtgtttttccctattccgtgacgatgatggagcgccacccgctcggt
agccagagcttttcgccgctccaggaccggccatggctggtcgtggtcgccgaagatgaa
ggcgggcggcccggccggccaagggtcttcctcgcaaacggcagacagggcgtgaactac
gcccgcaatatctggcaccatccgcttatgtcggtgggcgttgcaagcgacttcatcgtc
gtcgaccgagaggggccgggcagcaatctggaagagttctattacgacgaggctttcgtc
attcgcgatccgtttgaaggcggatga

DBGET integrated database retrieval system