KEGG   Sinorhizobium medicae: Smed_4494Help
Entry
Smed_4494         CDS       T00555                                 

Definition
(RefSeq) guanine deaminase
  KO
K01487  guanine deaminase [EC:3.5.4.3]
Organism
smd  Sinorhizobium medicae
Pathway
smd00230  Purine metabolism
smd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Smed_4494
Enzymes [BR:smd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.3  guanine deaminase
     Smed_4494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 Epimerase_2
Motif
Other DBs
NCBI-GeneID: 5319186
NCBI-ProteinID: YP_001313227
UniProt: A6UI14
Position
pSMED01:complement(977901..979208)
Genome map
AA seq 435 aa AA seqDB search
MTAILIRGRTLSFHREPQGIDDKASYAYESDGALLVENGVITASGAYAMVQAGAPENVAE
VDHRPDLIVPGFIDTHLHFPQMQVMASYAANLLEWLNSYTFPEECRFVETAHAERIARHF
FDEMVRHGTTTAAAYCSVHKTSADAFFAESVKRGMCMVAGKVMMDRNAPQGLLDTPETSY
DETRAVIADWHGKGRNHVAITPRFAITSTPEQMEAVRSLVDEFPDLHVQTHLSENRDEIA
YTLELYPEAADYTDVYARYGLLGPKSLFGHCIHLSEREADAMSDTGSIAVFCPTSNLFLG
SGLFPLRALTRRQRPVRVSVASDIGGGTSYSMMKTLDEAYKILQLQGERLNPFDSFYMMT
RGNAEALSLAGRIGTLEPGTDADLAVLDMAATPAMALRAEVVNSLADELFLLQTMGDDRA
VVETYVAGKPCKSML
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatcctcattcgcggccgcactttaagcttccatcgcgaaccgcagggcatc
gacgacaaagcctcctatgcctatgagagcgacggcgcccttctcgtcgagaacggcgtg
atcaccgcatccggcgcctacgcgatggtccaggcgggtgcacctgagaacgtggcggag
gtcgatcaccggccagatcttatcgtaccgggcttcatcgacacacatctgcattttccg
cagatgcaggttatggcctcctatgcggcgaacctgcttgaatggctgaacagctacact
tttcccgaggaatgccggttcgtcgagactgcgcatgcggagaggatcgcccggcatttc
ttcgacgagatggtccgccatggcaccacgaccgccgcagcctattgttccgtacacaaa
acgtccgccgacgccttcttcgccgagagcgtgaagcgcggcatgtgcatggtggccggc
aaggtgatgatggatcgcaatgcgccccagggactgctcgacacgcccgagacgagctat
gatgaaacgcgggcggtcattgcggactggcatggcaaggggcgcaaccatgtggccatc
acgccgcgcttcgcgatcacttcgaccccggagcagatggaggccgtgagatcgctcgtc
gacgagtttcccgacctgcatgtgcagacgcacctttcggaaaatcgcgacgagatcgcc
tacacgctggaactctatccggaagcggcggactatactgacgtctacgcccggtatggt
ctgctcggaccgaaaagcctcttcggtcattgcattcacctgtccgagcgtgaagccgat
gccatgagcgacaccggctcgatcgccgtcttctgcccgacctccaatcttttccttggt
tccggcctgttccctttgcgggcactgacgcggcgacagcggccggtgcgcgtctcggtc
gcatcggacatcggcggcggcaccagctattcgatgatgaagacgctcgatgaagcctac
aagattctgcagttgcaaggcgaaaggctgaaccccttcgacagcttctacatgatgact
cgcggcaatgccgaggcgctgtcgctcgccggccgcatcggcacgctggagcccggcacg
gatgccgacctcgcggtcctcgacatggcggcaacaccggcaatggcactcagggccgaa
gttgtcaattctctggccgacgagcttttcctcctgcagacgatgggtgacgaccgcgct
gtcgtcgagacctacgtcgcaggaaagccatgcaaatcaatgctttag

DBGET integrated database retrieval system