KEGG   Sinorhizobium medicae: Smed_4496Help
Entry
Smed_4496         CDS       T00555                                 

Definition
(RefSeq) LysR family transcriptional regulator
  KO
K03566  LysR family transcriptional regulator, glycine cleavage system transcriptional activator
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:smd03000]
    Smed_4496
Transcription factors [BR:smd03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    Smed_4496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-GeneID: 5319188
NCBI-ProteinID: YP_001313229
UniProt: A6UI16
Position
pSMED01:complement(980560..981489)
Genome map
AA seq 309 aa AA seqDB search
MHQENLSMKMSKQFPLNALRVFEAAARLGSFTKAGDELGMTQTAVSYQIRLIEENIGEPL
FLRRPRQIALTEVGQHLAPKVTEAFEMLHDAVASARGNAEAALLINSTATFASQWLAREI
GTFQLEHPNIAVRLVANDAIIDFNKEAVDVAIRSGMGDWPGLASHRLMRVEFTPMLSPAL
AETVGGVRTPRDLLKLRIIDPRDPWWSLWFRAAGVDDPDLDGRPGSRLGAQAFEARAAVA
GQGVAILMPEFYSDDVALGRLYQPFELRCSDGHDYWLVYPHARRNAPKIRAFRDWILGKL
DPDTHRDAH
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaagagaacttatccatgaagatgtcgaagcagttcccgctgaatgcattgagg
gtcttcgaagcagccgcccgcctcgggagtttcaccaaggcgggcgacgagctcggcatg
acccagacggcggtcagctaccagatcaggctgatcgaggagaatatcggcgagccgctg
ttcctgagacgcccgcggcagatcgcactcacggaagtcgggcagcacctggctccgaaa
gtgacggaagccttcgagatgctgcacgacgcagtcgcctcggcccgcgggaatgcagaa
gcagccttgctcatcaactcgacggcaacctttgcctcgcaatggctcgcccgggaaatc
gggaccttccaactggagcatccgaatattgcggtgcgtctggtggcaaacgacgcgatt
atcgatttcaacaaggaggcggtggacgtagcaatccgctccggcatgggcgactggccg
ggcctcgccagccataggctgatgagggtggagtttacaccgatgctcagccccgccctt
gcggagacggtcggtggcgtgcgcactccgcgggacctcctgaagctccgcatcatcgac
cctcgagatccctggtggtccttgtggtttcgcgctgcgggcgtggacgatccggatctg
gacgggcgtccaggaagccggctcggcgcccaggccttcgaagctcgggcggcggtcgct
ggccagggcgtcgcgatcctgatgcctgaattctatagcgacgatgtggcgctcggccgg
ctttaccagccgttcgaactgcgatgcagcgacggccacgattactggctcgtctatccg
cacgcccgccgcaacgccccgaagatccgagccttccgggactggatcctcggcaagctc
gaccccgacacccatcgagacgcgcattga

DBGET integrated database retrieval system