KEGG   Sinorhizobium medicae: Smed_4497Help
Entry
Smed_4497         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5317937
NCBI-ProteinID: YP_001313230
UniProt: A6UI17
Position
pSMED01:981571..981774
Genome map
AA seq 67 aa AA seqDB search
MSCDVSEFAERRPLIPLGGVVRLAASALRRMRGHSISLDLDSTSDYMKKDLGLLDGRMAR
QDDDILR
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgcgatgtatcggaatttgctgaaagaaggccgcttatccctctgggcggggtc
gtccggcttgccgcctcggcgctacgccgcatgagaggccacagcatcagtctcgacctc
gattcaacatcggactacatgaaaaaggacttgggacttctcgacggccgcatggcccgg
caggacgacgacattctgcggtag

DBGET integrated database retrieval system