KEGG   Sinorhizobium medicae: Smed_4502Help
Entry
Smed_4502         CDS       T00555                                 

Definition
(RefSeq) regulatory protein ArsR
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_20 HTH_5 MarR_2 TrmB HTH_24 Rrf2 HTH_Crp_2 GntR HTH_9 MarR DUF4423
Motif
Other DBs
NCBI-GeneID: 5317942
NCBI-ProteinID: YP_001313235
UniProt: A6UI22
Position
pSMED01:988339..988662
Genome map
AA seq 107 aa AA seqDB search
MSDAYDMLFRTLSDPTRRALFERLCREGERTVGALTDKAGVSQPVVSKHLGLLKQAGLVR
DRHEGRHTYYSAQLGALAPLVDWTREMAGFWQSRFDDLEDLLKRMDQ
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgcgtacgacatgctcttcagaacgctttccgatcccactcggcgggctctt
ttcgagcggctgtgtcgcgaaggggaaaggacggttggagctctcacggacaaagcgggc
gtctcgcagccggtcgtctccaagcatctggggctgctgaagcaggcagggctcgtgcgc
gaccgccacgaaggccgccacacatattacagcgcgcagctcggcgcgctcgctcccctg
gtcgactggacgcgtgagatggccggattctggcagagccgcttcgacgatctcgaagat
ctactgaaaaggatggaccaatga

DBGET integrated database retrieval system