KEGG   Sinorhizobium medicae: Smed_4505Help
Entry
Smed_4505         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1801
Motif
Other DBs
NCBI-GeneID: 5317945
NCBI-ProteinID: YP_001313238
UniProt: A6UI25
Position
pSMED01:989386..989844
Genome map
AA seq 152 aa AA seqDB search
MASKTPGKTERAAKRDSSDGKPVLLSGGNPQIAKGYGDAPVKAYIAAMPDWKKDLGRRLD
ALIVDAVPNVCKAIKWNSPFYGMENDVWFLSFHCFTKYVKVTFFRGASLNPVPPGKSKYP
EVRYLDIHEGQLDEGQFSAWVRQASRLPGERM
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaagacacccggcaaaaccgagagggccgcaaagagggattcttccgacgga
aagccggtccttctttccggcggcaatcctcagatagcaaagggctatggcgacgccccc
gtaaaggcctatatcgcagccatgcccgattggaaaaaagaccttggacgtcgcctcgat
gcgctcatcgtggacgccgttcccaacgtatgtaaggccatcaaatggaactcgcccttt
tacggcatggagaacgacgtctggttcctcagctttcactgtttcacgaaatacgtcaaa
gtgactttctttcgcggcgcatcgctcaatcctgtcccgcccggcaagtcaaaatacccg
gaagtacgctacctcgatatccatgagggtcaactcgatgaagggcaattctccgcctgg
gtcaggcaagcaagccgattgcccggcgagcggatgtga

DBGET integrated database retrieval system