KEGG   Sinorhizobium medicae: Smed_4508Help
Entry
Smed_4508         CDS       T00555                                 

Definition
(RefSeq) methionine aminopeptidase
  KO
K01265  methionyl aminopeptidase [EC:3.4.11.18]
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:smd01002]
    Smed_4508
Enzymes [BR:smd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.18  methionyl aminopeptidase
     Smed_4508
Peptidases [BR:smd01002]
 Metallo Peptidases
  Family M24
   Smed_4508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M24
Motif
Other DBs
NCBI-GeneID: 5318071
NCBI-ProteinID: YP_001313241
UniProt: A6UI28
Position
pSMED01:991539..992288
Genome map
AA seq 249 aa AA seqDB search
MTLNNDDDLERLKEIGRICANALQTMGEALEPGITTAELDAIGRKVMEEAGARSAPELCY
AFPGATCISVNEEIAHGIPGSRVIQAGDLVNIDVSAEKGGLFADTGASFPVPPVTAAIDR
LCRDGKRAMWVGLKQVKPGQPLAAIGNSIGAFARKNRYSLVANLASHGIGRSLHEEPSEI
ATWPDPSERRRMAEGMVFTVEPFLSMGAQWAEGGDDDWTLYSEPRAPTVQYEHTVVVTRS
GPLVVTLPG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcaacaacgacgacgacctggaaaggctgaaggaaatcggccggatttgcgcc
aatgcgctccagacgatgggcgaggcgctggagccggggatcaccacggccgagctcgac
gcgatcggccgcaaggttatggaggaggcgggcgctcgctccgcacctgagctttgctat
gcatttccaggggcgacctgcatcagcgtcaatgaggagatcgcgcacggcatacccggt
agccgcgtgatccaggcaggcgatctcgtcaacatcgacgtttcggccgagaagggcggc
ctctttgccgatacgggcgcatcctttcccgtgccgccggtcactgcggccatcgatcgt
ctttgccgtgacgggaagcgcgctatgtgggtggggttgaagcaggtcaagccgggccag
ccgctggccgcgatcggcaattcgatcggtgcctttgcgcgcaagaaccgttactctctg
gtcgccaatctggccagccacggtatcggccggtcgctgcatgaggagccgagcgaaatc
gcaacctggcccgacccgtctgagcggcggcggatggccgagggcatggtcttcactgtc
gagcccttcctgtcgatgggggcgcagtgggcggaaggcggagacgacgattggacgctc
tatagcgaaccgcgcgcgccgaccgtgcaatacgagcatacggtcgtcgtcacccgcagc
gggccattggttgtgacgctgccaggttag

DBGET integrated database retrieval system