KEGG   Sinorhizobium medicae: Smed_4509Help
Entry
Smed_4509         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_4 MFS_1
Motif
Other DBs
NCBI-GeneID: 5318072
NCBI-ProteinID: YP_001313242
UniProt: A6UI29
Position
pSMED01:992444..993622
Genome map
AA seq 392 aa AA seqDB search
MPSGLAATAIAGAIAMAVAMGFGRFSYTPILPAMMADTGISPGDAGLIAAANFIGYLAGA
VLAGYGWAHGRERGLGLAALVSTTLLLAAMGLTSSVIAFCIIRFLAGLASAFAMIFISGI
VLGQGLAARSEHVPSVHFGGVGFGIALSSIVVWVAPLAGAAGISASQADWFAGGLVALVG
AVAVAALLPASRHAKSGGRPEARLVATRPLIAVTLTYGFFGFGYVITATFLVAMARDASG
GHSVEFLAWLITGISAALSIYLWRFAVPHFGLAGVYAAGLLVEAAGLVLTVSLPSPYAPL
VGGLMLGATFMMITAYGLQMGRQLAPESPRRALAFMTAAFGLGQIVGPLVAGWLADRTGS
YALPTLVAAVVLLICGIVVLAELRRINAALAQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcggtctggcggccaccgcgatcgccggcgcgatagccatggcggtcgccatg
ggcttcggccggttctcctacacccctatcctgccggcgatgatggccgacaccgggatt
tctccgggggatgccgggctgatcgccgccgcgaatttcattggctatctcgcgggcgcg
gtgctcgccggctatggttgggcgcacggccgcgaacgcgggctcggccttgcggctctg
gtctcgaccaccctgctgctcgccgcgatggggcttacatcgtccgttatcgccttttgc
atcatccgctttctggcaggcctggcgagcgcctttgcgatgatcttcatctcgggaata
gtgctggggcaggggctcgccgcacgatccgaacacgtgccttcagtgcatttcggcggc
gtcggtttcggcatcgcactctcatcgatcgtggtctgggtcgcgcccctcgcaggcgcc
gcgggtatttctgcgtcgcaagccgactggttcgcgggcggacttgtcgcgttggtgggc
gctgtcgcggtggccgcgctgctgccagcgagccgccatgccaaaagcggcggccgaccg
gaggcgcgccttgtcgcgacgcggcctctcatagccgtgacgctcacctatggctttttc
ggtttcggctacgtgatcacggcgacctttctcgtcgccatggcccgggatgcaagcggt
ggccacagcgtcgagttcctcgcctggctgatcaccggtatcagcgcggcgctttcgatt
tatctctggcgtttcgccgttccgcatttcgggctcgccggtgtctatgcggccggcctg
ctggtcgaggcggccggtctcgtgctgacggtttccctgccttcgccctacgcgccgctt
gtcggcgggctgatgctcggtgctaccttcatgatgatcacggcctacggcctgcagatg
ggccggcagctcgcccccgaaagcccgcgccgcgcgctcgccttcatgacagccgccttc
ggactcggccagatcgtcgggccgctcgtcgcgggatggcttgcggaccggaccggaagc
tacgctttgccgaccttggtcgcagctgtcgttctgttgatctgtggaatcgtcgttctc
gccgaactgcgcaggataaatgccgccctggcgcaatga

DBGET integrated database retrieval system