KEGG   Sinorhizobium medicae: Smed_4510Help
Entry
Smed_4510         CDS       T00555                                 

Definition
(RefSeq) transporter
  KO
K17938  peptide/bleomycin uptake transporter
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smd02000]
    Smed_4510
Transporters [BR:smd02000]
 Other Transporters
  Others
   Smed_4510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SbmA_BacA ABC_membrane_2
Motif
Other DBs
NCBI-GeneID: 5318073
NCBI-ProteinID: YP_001313243
UniProt: A6UI30
Position
pSMED01:993776..995038
Genome map
AA seq 420 aa AA seqDB search
MFQSFFPKPKLFFISSAVWSLLAVLAWYGGGRDIGAYLGLPPLPPGQEPIIGVSVFWSTP
FLWFYVYYAVVVALFSAFWFAYSPHRWQYWSVLGTALIIFNTYFSVQVSVAINAWYGPFY
DLIQQALARTAPVTAGQLYSGMVGFAGIAFVAVTVGVLNLFFVSHYIFRWRTAMNEYYVT
HWPRLRHVEGASQRVQEDTMRFSSTVERLGVGLVSSIMTLIAFLPVLFKFSEQVNVLPIV
GEIPHALVWAAVFWSVFGTVFLAAVGIKLPGLEFRNQRVEAAYRKELVYGEDHEDRADPV
TLGQLFDNVRRNYFRLYFHYMYFNIARIFYLQADNLFGTFVLVPAIVAGKLTLGVMNQVL
NVFEQVRTSFQYLVNSWTTIVELLSIYKRLKAFESVLDDEPLPEIDRQFIDAGGKEELAL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
ttgttccagtccttttttccgaagccgaaactgtttttcatatcatccgccgtctggagc
cttcttgccgtccttgcatggtatggcggaggaagggatatcggcgcttacctcggcttg
ccgccgctcccgcctggacaggaaccgatcatcggagtgtccgtcttctggtcgacaccc
tttctctggttttacgtctattacgctgtggtcgtcgccctgttttctgcgttctggttc
gcctacagtccgcatcggtggcaatactggtcagtcctcggcacggcgctcatcatattc
aacacctatttctcggttcaggtcagcgtcgccatcaatgcgtggtacggcccgttctat
gatctgatccagcaggcgcttgcgcgcacagcgcccgtgacggcaggtcagctctattcg
gggatggtcggcttcgccggcatcgctttcgtggcggtgacggtcggcgttctcaatctc
tttttcgtcagtcactacatttttcgctggcgtacggcgatgaacgaatactacgtcacc
cactggccgaggctgcgccacgtcgaaggtgcatcgcagcgtgtgcaggaagacacgatg
cgtttttccagcacggtggaaaggctgggtgtcggcctcgtcagttcgatcatgacgctg
atcgcgtttttgccggtgctcttcaagttttccgagcaggtaaacgttctgccgatcgtc
ggcgaaataccgcacgccctcgtctgggcggccgtattctggtccgttttcggcacggtt
tttctggctgcagtcggtatcaagctcccgggactggaatttcgcaatcagcgggtcgag
gcggcttatcggaaggaactggtctatggtgaggatcacgaggaccgcgccgatccggtg
acactcgggcagctgttcgataacgtcaggcgtaactatttccgcctgtatttccattac
atgtacttcaacatcgcccgcatcttctaccttcaggcagacaacctgtttggtaccttc
gttctggtgccggcgatcgtggcgggaaagctgacgcttggcgtcatgaaccaggtcctg
aacgtcttcgagcaggtgcgcacgtcgttccagtatctcgtcaattcctggaccacgatc
gtcgagcttctttcgatctacaaacgtctcaaagcctttgaatcggtgttggacgacgaa
ccgctgccggaaatcgaccgccagttcatcgacgctggcggtaaagaagagttggccttg
taa

DBGET integrated database retrieval system