KEGG   Sinorhizobium medicae: Smed_4511Help
Entry
Smed_4511         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1
Motif
Other DBs
NCBI-GeneID: 5318074
NCBI-ProteinID: YP_001313244
UniProt: A6UI31
Position
pSMED01:complement(995048..996046)
Genome map
AA seq 332 aa AA seqDB search
MIRISLALSVALFPALALADPPSARQLPKQLVVISFDGAHDNALWQKSLTMGKRTGARFT
YFLSCTFLMTRADGKQTYRAPGQKPGRSNVGFAQSREDIAMRAGHVWQAHLAGHEIGSHA
CGHFDGKDWSKADWASEFSAFRAALANAWKRAGKPEAEPEGWADFAQGGIKGFRAPYLSL
SDGLVPALKTFGFSYDASLVTKGPGWPSFADGLIRFGLPLIPEGPSHRPVIGMDYNLFVR
HSMGVENSRDSARFEERTLAAFRNAFRKEYEGERIPLQLGFHFVEMNGGAYWRALDGFLS
ETCSKPDVACVSYAEALPLIENARKKADRSAF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtatttctttggctttatccgttgctctttttcccgctctcgccctcgccgat
ccgccgtcggctcgccagttgccaaagcagctcgtcgtcatctcgttcgatggcgcgcac
gacaatgcgctttggcagaaaagcctcacaatgggcaagcgcacgggcgcgcgtttcacc
tatttcctctcctgcaccttcctgatgacgagagctgacggaaagcagacctatcgcgcg
ccgggtcagaagccgggccgctcaaacgtcgggttcgcgcaaagccgtgaagacatcgcg
atgcgcgccggccatgtctggcaggcgcatctcgctggccacgagatcgggagccatgcc
tgcggccatttcgacggaaaggactggagcaaggcggactgggcaagcgagttttccgcg
ttccgcgcagcgctggcgaacgcctggaagagggccggcaaaccggaagccgagccggag
ggctgggccgatttcgcgcaaggcggcatcaagggttttcgcgccccctacctgtctctc
agcgacggcctcgtgcctgcactgaagacattcggtttcagctatgatgcgagcctcgtc
accaaggggcccggctggcccagcttcgcagacggacttatacgtttcgggctgccgctc
atcccggaaggcccttcccaccgcccggtcatcgggatggactacaacctcttcgtccgt
cattcgatgggagtcgagaacagcagagacagcgcccgcttcgaggaacgaacgcttgcc
gcgtttcgcaatgcctttcgcaaagaatacgaaggcgagcgcatacccctccagcttggc
ttccacttcgtcgagatgaacggcggcgcctattggcgagccctcgacggctttctgtcg
gaaacctgcagcaagcctgacgtcgcctgcgtcagctacgccgaggccctgccgctgatc
gagaatgcgagaaagaaggcggatcgctccgccttctga

DBGET integrated database retrieval system