KEGG   Sinorhizobium medicae: Smed_4513Help
Entry
Smed_4513         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_21 TPR_2 TPR_16 TPR_1 TPR_19 TPR_6 ANAPC3 TPR_12 MacB_PCD
Motif
Other DBs
NCBI-GeneID: 5318076
NCBI-ProteinID: YP_001313246
UniProt: A6UI33
Position
pSMED01:996939..997607
Genome map
AA seq 222 aa AA seqDB search
MVNQDDSFIREVNDELRSDQMKAVWTRFGSIIIGIAVLIVLGTVGKVGYDYWQESSSSQS
GDTFLVALNLARENKSDEALAALTGLEKEGYGSYPVLAQLRLATLQAQKGETDAAVKAFS
GIGRDTRIPTALRDAARLRAAYLLIDAGTYEQVSSEVEQLAVPQNAMRHSAREALGLSAY
KAGDYAKAKSWFQQIVDDTESPRGVMNRAQMLLDVIASSGKA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaccaggacgacagctttatccgcgaggtcaacgacgaactccgctcggaccag
atgaaggcggtctggacgcgcttcggcagcatcatcatcggaattgccgtgctgatcgtg
ctcggcaccgtcggcaaggtgggatacgactattggcaggagtcgtcctcgtcacaatcg
ggcgacacctttcttgtcgcgctaaatcttgcacgggagaacaagtcggacgaggcactc
gccgcgttgaccgggctggagaaggaaggttacggatcctatccggttctggcgcaactg
cgcttggcgacgttgcaggcgcaaaaaggtgaaacggacgctgcggtcaaggcattctcg
gggatcggcagggatacgcgtatcccaacggcgcttcgcgacgcggcgcggcttcgtgcc
gcttacctccttatcgatgcgggaacttacgagcaggtctcctcggaggtcgagcaactg
gccgtcccgcagaacgccatgcgtcattccgcgcgtgaggcgctcggtctttcagcctat
aaggccggcgactatgccaaggcaaagagctggtttcagcagatcgtcgacgataccgaa
agcccgcgcggggtcatgaaccgggcgcagatgctgctggacgtcatcgcctcgagcggt
aaagcctga

DBGET integrated database retrieval system