KEGG   Sinorhizobium medicae: Smed_4516Help
Entry
Smed_4516         CDS       T00555                                 

Definition
(RefSeq) acyl-CoA dehydrogenase type 2
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_N Acyl-CoA_dh_1 Acyl-CoA_dh_M
Motif
Other DBs
NCBI-GeneID: 5318079
NCBI-ProteinID: YP_001313249
UniProt: A6UI36
Position
pSMED01:complement(999986..1001173)
Genome map
AA seq 395 aa AA seqDB search
MGSISQFAGKTRPAPRHIESEEEALTVAKDLAFRFAERASERDLERILPHDELDQLAQSG
LLAISIPSEYEGIDVSNVVLAEVTAILSEADSSIGQIPQGHFHALEALRQYATEEQKQFF
FGRARAGDRFSSAISESSEKTIGSPITRIIGDGAGYRINGRKEYLTGILFADWIAISALD
ATELMTLSFVPRTTEGVRIIDDWDSFGQRVNGSGTAILENIHVDRSSVVPYHRAFGRQTT
IGSVGQIINAGVDLGIARAAFRETLEYVRNGADSSEDALAIAKIGEVAIRLEAATALIEY
AGLKVDTAQVDPTEAHAAEASITVTAAKVLAAEAALEASNTLFDLAGAASTKVSQNLDRY
WRNARAHASQDPLRRKHHLVGNYHLNGVRPRDGSL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcatctcgcaattcgccggaaagaccagacctgcgccccgccacatagagagc
gaggaagaggctctgacggtagcaaaagacttggcattccgatttgccgagcgcgccagc
gagcgcgatcttgaacgcatcctcccccatgacgaactcgaccagctggcacagtcagga
ctgctggcgatcagcattccctcggaatacgagggaatcgacgtctcaaacgtcgtcctg
gccgaggtgacggcaatcctgtccgaggccgacagctccatcggccagatcccgcaaggc
cattttcatgccctggaagcactgcgccagtatgccacagaagagcaaaagcaattcttc
ttcggacgtgcccgggccggcgaccgcttcagcagcgcaatttcggaaagcagcgaaaaa
acaatcggtagcccgataacccggataatcggggacggcgccggctaccgcatcaacgga
cggaaagaatatctgaccggcatcctcttcgccgactggatcgcgatctcggctctggac
gcgaccgagctcatgaccctatcctttgtcccgcgcacaacggaaggcgtccggatcatc
gatgattgggacagcttcggtcagcgcgtcaatggcagcggcacagccattctcgagaac
atccatgtggatcgcagctcggtcgtgccgtatcaccgcgctttcggtcgacagacaacg
atcggttccgtcggccagatcatcaatgccggcgttgatctcggcatagcgcgcgccgca
ttccgcgaaaccctcgaatacgtgcgaaacggcgccgattcatcggaggatgctttggcg
atcgccaagatcggcgaagtcgcaatacgcctcgaggcggccaccgcgctcatcgaatat
gccggacttaaggtcgatacggctcaggtagacccgacagaagcgcacgcagccgaggcg
agcatcacggtcaccgccgccaaagttcttgccgccgaggccgcactggaggcatccaac
acacttttcgacctcgccggcgccgcctccacaaaggtctcccaaaatctggatcgctat
tggcgcaatgcccgcgcccacgcgtcacaggacccgcttcgccggaagcatcacctcgtg
ggcaactatcaccttaacggcgtccgaccgcgcgacggatcattgtga

DBGET integrated database retrieval system