KEGG   Sinorhizobium medicae: Smed_4517Help
Entry
Smed_4517         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_9 NAD_binding_8 Pyr_redox_3 ERAP1_C
Motif
Other DBs
NCBI-GeneID: 5318080
NCBI-ProteinID: YP_001313250
UniProt: A6UI37
Position
pSMED01:1001730..1003130
Genome map
AA seq 466 aa AA seqDB search
MTVRGLFARRSAMAALSKPEIAIVGRGFSGIMMAIALMKSMRVSFHLTMYDPHPSISGGQ
VFSAAQRCEILNSRVRDLSVAAGQPDDFNDWLCANDEFRTAVPAAIPGFRQIFVPKGIFS
DYVHQRFSEALARRSDITVRFSHEPVTGLRKLASGRFSLVRHGGNDESDIVILATGFGMR
PRDLEVSEEERPLVRTRRLVDPRHAVLLGSGIRVVDQLFQMRDNGYAGKVTLISRHGFLP
QAHTQRAASPSFPVDPLPQGLGRIVRFVRQACAEAEANGQGWQSAMNGLRRRARSLWQSL
SAQEKRQFNRHLRAIYDSHRNRLPAAVHARLQQELGEGRTVLRRGRAGRRLPEGILVRWA
GQDTEELLRADQVIECRCSAPDLGTPLLRSLIAGGLAQPDELELGIAVAPTGEVLSSSGH
TPNLFAIGPLGLGSLPDIDLVPEIVTQTYAASRLIATGKRMTLKAG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcgtggattgtttgcccgcaggtcagcaatggccgccttgtcgaagccggaa
atcgcgatcgttggccgcggtttttcgggcatcatgatggcgatcgcgttgatgaaatcg
atgcgggtatctttccacctcaccatgtatgatccgcatccatcgatcagcgggggccag
gtattttccgccgctcagcgctgcgagatactcaacagccgcgtccgcgatctttcggtc
gcggccggccagccggatgatttcaacgattggctctgcgccaatgatgagttccgaacg
gcggttccggcggccattcccggcttccggcagattttcgtgccgaaaggcatcttcagc
gattacgtgcaccagcgcttctccgaggcgcttgcccggcgctccgacatcacggtgagg
ttctcacacgagccggtcacaggcctgcgaaagctcgcaagtggtcgcttcagccttgtg
cggcacggtggcaacgacgagagcgacattgtcatcctcgctacgggcttcggcatgcgc
ccgcgggacctcgaggtttccgaggaggagcggccgcttgtgcgcactcggcgcctcgtc
gatccacgccacgcggtgctgctcggtagcgggatacgtgtggtcgaccagttgttccag
atgcgcgacaacggctatgcgggaaaggtcacgctcatttcgcggcacggtttcctgccg
caggcgcacacgcagcgcgcggcatcgccgagctttcccgtcgatccgctgccgcaaggc
ctgggccgtatcgtgcgcttcgtgcgtcaggcctgcgccgaggccgaagcgaacgggcag
ggatggcaatctgcgatgaacggcctccgccgccgcgctcgctctctctggcaatcgctc
tccgcacaggagaagcggcagttcaaccgtcacctgcgtgcaatttacgacagccacagg
aaccgcctgccagcggccgttcacgcgcggctgcagcaggaacttggcgagggtcggacc
gtgcttcgccgcggccgggcgggtcgacgcctgcccgaaggtatcctcgtgcgatgggcc
ggccaggataccgaggaactgctgagggctgatcaggtgatcgaatgtcgctgttcagct
ccggacctcggaacgccgttgcttcggagccttattgcgggcgggcttgcccaaccagac
gaactcgagctcggcattgctgtcgccccgacgggcgaagtcttgagctcgagcggacac
acgccgaacctcttcgccatcggtccgttgggattgggaagccttcccgacatcgacctc
gtaccggaaatcgtcacgcagacctatgcggcatcacggctgatagcgacaggaaagcgc
atgacgctgaaagctggatag

DBGET integrated database retrieval system