KEGG   Sinorhizobium medicae: Smed_4518Help
Entry
Smed_4518         CDS       T00555                                 

Definition
(RefSeq) FAD dependent oxidoreductase
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_9 K_oxygenase Pyr_redox_2 NAD_binding_8 DAO Pyr_redox Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 5318493
NCBI-ProteinID: YP_001313251
UniProt: A6UI38
Position
pSMED01:1003250..1004707
Genome map
AA seq 485 aa AA seqDB search
MMDSFGQNAPRPTVAIIGGGFTGAMVAMHLARDRAMDGWQIAVFEPRVRLGCGLAYDTAE
PAHRVNVPAARMSIDPDDPDDFARWLALQSELRDDPEVLAGDGHLYPRRQLFGRYVAEAV
VPFVRSGRIVHHRERVIAVEREGAAWAVRGEGGTLNRADALVVATTHPAPEAPAGFGAVL
TGHPRYVPDSTEPGALDKIRTDDRVLIIGTGLTSADVIATLRTRGHKGPITAFSRRGLRS
RGHADRAQDPFGDFVAPPWRSAAELLAQVRRTISDAEAEGFTWHAVLDALRAQGGEIWRN
LPVDERRRLVRHARPFWDVHRFRVAPQIDAIVSTGLKDGDIRVRAGSIAHLARAGENVAV
TFRGRRAGGTEEWKFDAVVITTGPAHRSILQSQPWLESLGAAGYLRPDTVGLGLACSEAS
RALDGEGEEVDDLFVAGPLARGTFGELMGLPQVNDHAIFVAAQIAALAQARRAESVRSRR
EEAAT
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgatggattccttcggccagaacgccccacgccctaccgtcgcgatcatcggcggcggc
ttcaccggagccatggttgcgatgcaccttgcgcgcgatcgcgccatggacggttggcag
attgccgtcttcgagccgcgggtgcggctgggatgcggccttgcctatgataccgcggag
cccgcgcatcgcgtcaatgtcccggctgcgcgtatgagcatcgatccggatgaccccgac
gacttcgcacgctggctcgcacttcagagtgagctgcgcgacgatcccgaggtgcttgcc
ggcgatggacatctctatcctcgccggcagcttttcgggcgctacgttgccgaggcggtc
gtaccgttcgtccggagcgggcgcatcgtgcatcaccgggaaagggtgatcgccgtagag
cgtgagggagcagcctgggcggtccgcggcgagggcggcacgctaaaccgcgccgacgcg
ctggtggtggcgacgacgcatccggctccggaggcgcccgcaggcttcggcgctgtactg
accggtcacccccgctacgtgccggattcgaccgagccgggcgcgctcgacaaaatccgg
acggatgaccgcgtactgatcatcggtaccggactgacctcggccgacgtgatcgctacg
ctgcgcacgcgcgggcataagggaccgatcaccgccttttcccggcggggcctacgctcg
cgcggacatgccgacagggcgcaggacccctttggcgacttcgtcgcgccgccttggaga
tcagcagcggagctcctcgctcaggtgcgccggacgatatcagatgcggaggcggaaggc
ttcacatggcatgcggttctcgatgcgctcagggcacagggcggcgagatatggcgcaat
ttgccggtagacgagcggcgccggcttgtccggcacgcgcggcctttctgggatgtgcac
cgttttcgcgtggcgccgcaaatcgatgcgatcgtgagcacaggtctaaaggatggcgat
atccgcgtccgcgccggttctatcgcccatttggcgcgcgctggcgagaatgtcgcggtc
accttccggggccggcgggctggaggaacggaagagtggaaattcgacgccgtcgtgatc
accacgggtccggcccaccggtcgatcctgcaaagtcagccctggctggagtcgctcgga
gccgccggttatctgcgccccgacacggtcggactggggctcgcctgcagcgaagccagt
agggcgctcgacggcgagggcgaggaggtggacgatctattcgtcgccggtcctctcgcc
cgcggcacctttggcgaactcatgggtctgccgcaggtcaacgaccacgccattttcgtg
gcggcgcaaattgcggcgctggcgcaggcgcgccgagcagaaagcgttcgctccaggcgc
gaggaagccgcaacatag

DBGET integrated database retrieval system