KEGG   Sinorhizobium medicae: Smed_4519Help
Entry
Smed_4519         CDS       T00555                                 

Definition
(RefSeq) hypothetical protein
  KO
K07403  membrane-bound serine protease (ClpP class)
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NfeD
Motif
Other DBs
NCBI-GeneID: 5318494
NCBI-ProteinID: YP_001313252
UniProt: A6UI39
Position
pSMED01:1004915..1006273
Genome map
AA seq 452 aa AA seqDB search
MARILFLLFSLLSAFMLPVSPAPAAERKAIVLHVNGAISPATAEYVTRGLRRARDRGVAL
VVLQMDTPGGLDTSMREIIRAILDSPVPVASFVAPSGARAASAGTYILYASHIAAMAPGT
NLGAATPIAIGGGLFGDDERDGEETPGEPDKQEPRKPADAGEAKLINDAIAYIRGLAELR
GRNIDWAERAVREAASLSSAAAAREQVIDFTAINLNDLLKQAHGRSVRIGQSDVRLDTAG
LFIEDLPPDWRTQLLSVITNPNVALLLMMVGIYGLIFEFLSPGTVVPGTIGGISLLLGLY
ALAVLPVSYAGVALILLGAGLLVAEAHAPSFGVLGLGSAVALVLGAAILFDTDVPGLQVS
WPVLSGIGFASLAFGLLVARLALLSSRHKILTGAEEMIGISGKVDSWEGAGGYVIAHGER
WSAVSNEPLGPGEDVMVVGRQSLTLEVARKPT
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcatcctcttcctgttgtttagcctcctgtcggccttcatgcttcctgtctcg
ccggctccggcagccgagcggaaagcaatcgtcctgcacgtaaacggcgccatcagtccg
gccacggcggaatatgtaacgcgcggcctgcggcgggccagggaccgcggtgtcgcgctg
gtggtcctgcagatggatacgcccggcggactggatacgtcgatgcgcgaaatcatacgc
gccatcctcgattcacccgtgccggtcgcgagtttcgtcgcgcccagcggagcgcgggcg
gcaagcgccggcacctatattctttatgcgagccacatcgcggccatggcgcccggaacc
aatctgggcgccgccacgccgatcgccatcggcggtggactttttggcgatgacgagcgg
gacggcgaggaaacgccgggcgaaccggacaagcaggaaccccgcaagccggccgatgcc
ggcgaggcgaaacttatcaacgatgcaatcgcttatatccgcggccttgcggagttgcgc
ggtcgcaatatcgactgggcggagcgcgccgtgcgcgaggctgccagcctttcctcggcc
gcagccgcgcgcgaacaggtcatcgacttcaccgcgatcaacctcaatgacctcctcaag
caggcacacggtcgctccgttcgcatcggtcaatccgacgtccggctcgatactgcaggg
ctcttcatcgaggacttgccgcccgattggcgcacgcagctcttatcggtgatcaccaat
cccaatgtcgctctccttctgatgatggtcggcatctatgggctcatcttcgagtttctc
tcacccggcaccgttgtgcccgggaccattggcggcataagtctcctgctcggtctctac
gccctggcggtgctgcctgtgagctatgccggcgttgccctcatcctgctcggagccggg
ctgctggtcgcggaagcgcatgcgccgtctttcggcgttctcggccttggcagcgccgtc
gcgctggtgctcggtgccgcaattcttttcgacacggacgtaccgggactgcaggtgtcc
tggccggttctgagcggcatcgggttcgcaagcctggctttcggcctgctggtcgcccgt
ctcgctcttctctcgagccgacacaagatcctcaccggagcggaggagatgatcggcatc
tccggaaaggtcgacagctgggagggagcgggcggctacgtgattgcccacggcgagcgg
tggagcgcagtcagcaatgaaccgctcggtccgggagaggacgtcatggtcgtcggccgt
cagagtttgacgctggaggtggcgcgcaagccaacttga

DBGET integrated database retrieval system