KEGG   Sinorhizobium medicae: Smed_4527Help
Entry
Smed_4527         CDS       T00555                                 

Definition
(RefSeq) putative nitrate transport protein
  KO
K22067  two-component system, oxyanion-binding sensor
Organism
smd  Sinorhizobium medicae
Brite
Two-component system [BR:smd02022]
 Other families
  NasS-NasT
   Smed_4527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMT1_2 NMT1
Motif
Other DBs
NCBI-GeneID: 5318502
NCBI-ProteinID: YP_001313260
UniProt: A6UI47
Position
pSMED01:complement(1015026..1016333)
Genome map
AA seq 435 aa AA seqDB search
MNVLTKKSEFRGGKLSTGSALPAPGRIRHEGQRTIRAGFIPLVDAAVLIAAAEFGFAQRE
GITLELVKDVSWANVRDRLAFRQFDIAHMLSPMPVAARLGLGSNPSPTIAPFSLGRGGNA
ITLSTRIYGLMEEEGRLGGAADPLRNARALEAVVRSAAAAGKPPLTLGVTYPFSSHNYEL
RYWLAAGGIDPDRDVKLVVVPPPMTSDALSAGAIDGFCVGAPWNMIASERGVGRIVATKQ
DIWPSAPEKVIGMRPEWAEAKPDTVSRLIVALDRAARWSDVPENRARLAEVLAEDRHLGA
PVDIIRRVLAGEFTIDPEGNRRVVENYFVFHAGFANFPRPSQALWIYSQMVRWGQTTLSR
EGFEASVSAYRPDLYRGALGKDALPADADSGSLEGATDGDRFIDGHVFDPGRIEDYIKSF
TVFGKDGVQTPVDDV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtgttgacgaagaaaagtgaattcagaggcggtaagctctccaccggcagcgcc
cttcctgcccctggaagaatacgccatgagggacagcggaccatccgcgccggtttcatt
ccgctcgtcgatgcagccgtgctgatcgcggccgccgaattcgggtttgcgcagcgcgag
ggtattacccttgagcttgtcaaggacgtctcctgggcgaatgttcgcgacaggcttgcc
ttccgtcagttcgacattgcccacatgctctcgccaatgccggttgccgccaggctcggc
ctcggctcaaatccgtcgccgacgattgcccctttttcgctggggcgcggcggcaatgcc
atcactctgtcgacgcgcatctacggccttatggaagaggaaggaaggctcggaggagcc
gcggatccgttgaggaacgcccgggccctggaggcggtcgtccgcagcgcggcggcagcc
ggcaagccgccgctgacgctcggcgtcacctacccgttctcgtcgcacaattacgaactc
cgctactggcttgcggcaggcggcatcgatcccgatcgcgatgtcaagctggtcgttgtc
cccccaccgatgacctccgacgccctgtccgcgggcgcgatcgacggcttctgcgtcggc
gcaccttggaacatgatcgcatcggaacgcggcgtcggccgcatcgtcgcgacgaagcag
gacatctggccatcggcaccggaaaaggtcatcggcatgcgccccgaatgggccgaggcg
aagccggacacagtttcgcgcctgatcgttgcgctcgaccgagcggcccgctggtcggac
gttccagagaaccgcgcccgcctcgccgaggtcttggccgaggatcgccacctgggcgcg
ccggtcgatataatccgacgggtacttgcgggcgaattcacgatcgaccccgagggaaat
cgccgcgtcgtcgagaactatttcgtcttccacgccggctttgccaatttcccgcgcccc
agccaggcgctctggatctacagtcaaatggtgcgctgggggcagacgaccttgtcccga
gagggcttcgaagcgagcgtctcggcctatcggccggacctctaccggggagcgctcggc
aaggacgcgttaccggctgacgcggacagcggcagcctcgaaggagcaacggacggcgac
cgcttcattgacggccatgtcttcgatcccggcaggatcgaagattacatcaagtccttt
accgtctttggaaaggacggggtccagaccccggtcgatgacgtctga

DBGET integrated database retrieval system