KEGG   Sinorhizobium medicae: Smed_4530Help
Entry
Smed_4530         CDS       T00555                                 

Definition
(RefSeq) XRE family transcriptional regulator
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_26 YdaS_antitoxin Cnd3
Motif
Other DBs
NCBI-GeneID: 5317969
NCBI-ProteinID: YP_001313263
UniProt: A6UI50
Position
pSMED01:complement(1017885..1018343)
Genome map
AA seq 152 aa AA seqDB search
MNKKDPNPIDAFVGSRVRMRRLMIGLSQEKLADGLGITFQQVQKYEKGTNRIGASRLQAI
ADILGVHPSFFFQQEEGSTQSGRPSGDIHESQEISSFVASKEGIALNRAFLKIADPVLRK
KIISLVAAMAQSPESDQTPAQSGTRHTEPLHG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaggatcctaacccgatcgacgcctttgtgggctcgcgtgttcgcatgcgc
cggttgatgatcggcttgagccaggaaaagcttgccgacgggctgggcatcaccttccag
caagtccagaaatacgagaaaggcacaaaccgcatcggcgccagccggttacaggctatt
gccgatatactcggtgtgcatccgagctttttctttcagcaggaagaaggaagcactcag
tcgggcaggccctctggcgacattcacgaatcgcaggagatctcatccttcgtagcctcg
aaagagggcatcgcactcaatcgggccttccttaaaatcgccgacccggtgctccggaag
aagatcatctccctcgtcgcggcgatggctcaatcgcccgaatcggaccagacgccggct
caatccggcacccggcacacggaacctctccatggctga

DBGET integrated database retrieval system