KEGG   Sinorhizobium medicae: Smed_4535Help
Entry
Smed_4535         CDS       T00555                                 

Definition
(RefSeq) carbamoyl-phosphate synthase L chain ATP-binding
  KO
K01968  3-methylcrotonyl-CoA carboxylase alpha subunit [EC:6.4.1.4]
Organism
smd  Sinorhizobium medicae
Pathway
smd00280  Valine, leucine and isoleucine degradation
smd01100  Metabolic pathways
Module
smd_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:smd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Smed_4535
Enzymes [BR:smd01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.4  methylcrotonoyl-CoA carboxylase
     Smed_4535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C ATP-grasp ATPgrasp_Ter HlyD_D23 ATP-grasp_3
Motif
Other DBs
NCBI-GeneID: 5317974
NCBI-ProteinID: YP_001313268
UniProt: A6UI55
Position
pSMED01:1022515..1024503
Genome map
AA seq 662 aa AA seqDB search
MFSKLLIANRGEIACRIIRTARRLGIRTAAVYSDADGDALHVALADEAIRIGAAPAAQSY
LAIGSIVQAARSVGAEAIHPGYGFLSENADFAEAVGEAGMVFVGPPPAAIRAMGLKDAAK
ALMERAGVPVVPGYHGEEQDASFLAERAREIGYPVLIKARAGGGGKGMRRVERQDDFGSA
LEAARREAASAFGDGSVLLERYLTKPRHIEMQIFGDRQGNIVHLFERDCSLQRRHQKVIE
EAPAPGMTAEVRRAMGDAAVRAAQAIGYVGAGTVEFIADVTNGLEPDHFYFMEMNTRLQV
EHPVTEAITGTDLVEWQLRVAAGEPLPKKQADISINGWAFEARFYAEDPVRGFLPATGRL
THLSFPEDTARVDAGVRQGDTITPYYDPLIAKLIVHGQNRSAALGKLQDALKECRIGGTV
TNLDFLIRLTEEHEFRSGHPDTGLIDRETERLTAPVVPGDEALALAAIISTGALEPEMST
DPWSSLGSWQIWGDAHRTVAIDHADVRATVTLASRGRDQFAVRAGGSTLPVLVLDRIEGG
ARLEVAGKQRLIRFARDRESMTLFHHGRNLVFHLPDGLAGGQSSEVAEDELLAPMPGLVK
LVRVGAGDTVSKGQPLIVLEAMKMELTLSASREGTIANVHVTEGAQVSEGMVLVTLMEEA
AQ
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgttttcgaagctcctgattgccaaccgcggtgagatcgcctgccgcattatccgcacc
gcgcgccgcctcgggattcgtactgccgccgtctactccgacgcggacggagacgccctg
catgtggcgctcgccgatgaggcgatccggatcggggcggcgcccgccgcccagagctat
ctggcgatcgggtcgattgtccaggcggcaagaagcgtgggcgccgaggccattcacccg
ggatacggattcctttcggagaacgccgatttcgccgaagcggtcggagaagcaggcatg
gtattcgtcgggccgccgcctgccgcgatccgtgccatggggctgaaggacgccgccaag
gcgctgatggaacgggccggagtgccggtcgtacccggctatcacggcgaagaacaggac
gcatcctttctcgccgagagggcgcgggaaatcggttatccggtgctgatcaaggcgcgg
gcgggcggcggcggtaaaggcatgcggcgcgtggagcggcaggacgatttcggctcggcg
ctggaggcggcacgcagggaggccgcatccgccttcggcgatggttcggtgcttctcgag
cgttatttgacgaagccgcgccacatcgaaatgcagatcttcggcgaccgccaaggcaac
atcgtccaccttttcgagcgcgattgttcgctgcaacgcaggcaccagaaagtaatagag
gaggcgccggcaccgggcatgaccgcggaagtccgccgcgccatgggcgatgcggcggtc
agggccgctcaggcgatcggctatgttggtgccggtacggtggaattcattgccgacgtg
acgaacgggctcgagccggaccatttctatttcatggagatgaacacgcgcctgcaggtg
gagcatccggttacggaggcgattaccggcaccgacctcgtggaatggcagctgcgcgtt
gccgcgggcgagccgttgccaaaaaagcaggccgacatttccatcaacggctgggctttc
gaggcgcgtttttatgcggaggacccggtccgcggctttctgccggcaaccgggcgactg
acgcatttgagctttcccgaggacaccgcgcgggtcgatgccggtgtccggcaaggggat
acgataacgccttactacgatccgctgatcgccaagctgatcgtgcatggacagaaccgt
tcggcggcgctcggaaaattgcaggatgctctcaaggagtgccgcatcggcggcacggtc
accaatctcgactttctcatccgtctgacagaagagcatgagttccgctccggccatccg
gatacgggactgatcgatcgggagaccgagcggctgaccgcaccggttgtgcccggcgat
gaggcgttggctttggctgcaatcatttcgacgggagcgctcgaaccggaaatgtcgacc
gatccatggtcctcactcggttcctggcagatctggggtgatgcgcaccgcacggtggcg
atcgaccacgcggacgttcgcgcaacggttaccctggcctcgcgcggccgtgaccagttc
gcggtgcgcgccggcgggagtacactgcccgtccttgtgctcgaccgcatcgagggtggt
gcccggctggaggtagccggaaaacagcgcctgatccggtttgcgcgagatcgcgagtcc
atgacgctctttcaccacgggcggaatctggtgttccacctgccagacggattggctggc
gggcagagcagcgaggttgccgaagacgagctgcttgcgccgatgcccgggctggtgaag
ctggtcagggtcggggccggcgataccgtcagcaagggacaaccgctcatcgtgttggag
gcgatgaagatggagttgacgctctccgcttcgcgcgagggcacgatcgcgaatgttcat
gtcacggaaggcgctcaggtcagcgagggtatggtgcttgtcactcttatggaggaggca
gcgcaatga

DBGET integrated database retrieval system