KEGG   Sinorhizobium medicae: Smed_4539Help
Entry
Smed_4539         CDS       T00555                                 

Definition
(RefSeq) RES domain-containing protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RES
Motif
Other DBs
NCBI-GeneID: 5317978
NCBI-ProteinID: YP_001313272
UniProt: A6UI59
Position
pSMED01:1026604..1027104
Genome map
AA seq 166 aa AA seqDB search
MEALTLWRAFVPRWAHMPLSGAGAARFGGRWNPVGVPALYAARELSTAWAEYNQGFVQHP
ALIVQLELRDAVLADLTDFKVLADLDVDETIHSCEWRDMLDKGAVPQTHQLRTALLARDY
HGVIYPSFMSPGGTCVALWRWNGAKEPRLDVIDPEGRLPKSPASWV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
gtggaagcgctaacgctctggcgtgccttcgtaccgcgctgggcgcatatgccgctttcc
ggtgcaggtgccgcccgtttcggtggccgctggaatccggtcggggtacctgctctttat
gccgcgcgtgaactttcgaccgcctgggcggaatacaatcagggtttcgtgcagcatccc
gcgctcatcgttcagcttgaattgcgcgatgcagttctcgcagacctgacggatttcaag
gttctcgcggacctggacgtggatgagacgatccatagctgcgaatggcgcgacatgttg
gacaaaggcgcggtaccgcaaacgcaccagttgcgcaccgcgcttctggcgcgtgattat
cacggggtgatctacccctcctttatgtctcccggcggcacctgcgtcgcgctctggcgt
tggaacggtgcgaaagagccgcgcttggatgtcattgatcccgagggccggctgccgaaa
tcaccggcctcgtgggtttga

DBGET integrated database retrieval system