KEGG   Sinorhizobium medicae: Smed_4562Help
Entry
Smed_4562         CDS       T00555                                 

Definition
(RefSeq) phosphotransferase domain-containing protein
  KO
K04477  putative hydrolase
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP PHP_C DUF4062
Motif
Other DBs
NCBI-GeneID: 5319230
NCBI-ProteinID: YP_001313295
UniProt: A6UI82
Position
pSMED01:1049841..1050581
Genome map
AA seq 246 aa AA seqDB search
MNGQESICTSRPVFHRYRDLSRARLNVELQVHTSWTDGQATALEILQTAKERGLAALAFT
EHVREDTTWFPRFREEVLSAARGFDDISVYVGCETKAMDEDGRLDVSQDVLDRCDIVLGV
VHRFPDGRGGYLDFEQLSYEKTADLEFRLSMGMVKNAPIDVLAHPGGMSLRRHGRFPEAC
FRDMMTATLERQIAIEINSSYLVDMPAFLALCEEVNPFVSIGSDAHRLSELGHCRDQLLE
LGAGQS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggcaggaatcgatatgcactagcaggcccgtgttccaccggtaccgggatctc
agccgagcgcgattgaatgtggagctgcaggtccacacgagttggaccgacgggcaggcg
actgcgctcgaaatcctgcaaacggccaaggaacgcggtctcgcggcgttggcgttcact
gagcacgtgcgcgaagacacgacatggtttccccggttcagggaggaagtcctttctgcc
gcgcgtggttttgacgatatcagcgtctatgtcggttgcgagacgaaagccatggacgag
gacggccggctggatgtgtcgcaagatgtcctggatcggtgcgacatcgttctcggcgtc
gttcacaggttcccggatggccgcggcggatatctggacttcgagcagctttcttatgaa
aaaacggcggatctcgaattccgcctgtcgatgggcatggtcaaaaacgcgcccatcgac
gtcctggcgcatccgggcggaatgagcctgagacggcacggtcgttttccggaagcctgt
ttccgcgacatgatgaccgcgaccctcgaacggcagatcgcgatcgagatcaactcctcc
tacctcgtcgacatgccggcgttcctcgcgctgtgcgaagaagtaaacccgttcgtttcg
atcggttccgatgcgcatcggctgagcgaattgggtcattgcagagatcagctactcgaa
ctgggagcagggcagtcatga

DBGET integrated database retrieval system