KEGG   Sinorhizobium medicae: Smed_4570Help
Entry
Smed_4570         CDS       T00555                                 

Definition
(RefSeq) putative ATPGTP-binding protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 CheR Methyltransf_23 NodS
Motif
Other DBs
NCBI-GeneID: 5319238
NCBI-ProteinID: YP_001313303
UniProt: A6UI90
Position
pSMED01:1060445..1061317
Genome map
AA seq 290 aa AA seqDB search
MDTDRYAMTVSAKEFYSLSSNTIDLVSESAFFARLKMRNGTFKLTQPSRFRELEVAFRPF
IAERAASLGQILDVGVSTGLTTVELAKFLEGCGAKVRITATDLFVEAHIVEFAPGVTVFC
DPEGWPLQYDLRGLTVRPWIRRLDYVTLAFAPLLLSRFLLQPRLRARIRAGKSRQVQMIT
RSLPDNGKIRFVENDIMSRSHHLVGRFDLVRAANILNTNYFSLDQIRTAIENIHSYLSGP
GALVVVTRTNRALENAGTLFELREDGSFAALERVGGGSEIEKLLLDFRAS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtggacacggatcgttacgccatgaccgtaagtgccaaagaattttattcattgagttcc
aacacgattgatctggtatcggaatcagcctttttcgccagactgaagatgcgcaatggg
accttcaagctgacccagccatctcggttccgggagttggaggtcgcatttcggccgttc
atcgcggagcgggctgcctcactcggccagatcctggatgtgggtgtgtccaccggtttg
acgacagtggagctggccaagttcctcgaaggctgtggcgccaaggttcgcattacggcg
accgacctcttcgtcgaggctcacatcgtcgaatttgctcccggggttacggtattctgc
gatccggagggatggccgctgcagtatgatctgcggggattgaccgttcgtccatggatc
agaaggctggactatgtgacgttggcgttcgcaccgctcctgctgtctcgtttcctgttg
caaccgcgcctgcgtgcccggatacgggcgggcaagagcagacaggtgcaaatgatcacc
cgatcgttgcccgacaacggcaagataagattcgtcgagaacgacattatgagccggtcg
caccacctggtcgggcggttcgacctggtgagagcggcgaatatattgaatacgaattac
ttttcgctggaccagatccggactgcaatcgagaacatccattcatacctaagcggcccc
ggtgcactggtcgtggtgacccgcacgaaccgcgcactggaaaatgccggaactctgttc
gagctccgtgaggatggttctttcgccgcgttggagcgcgtcggcggcggctccgagatc
gaaaaacttcttctggacttccgggcatcgtga

DBGET integrated database retrieval system