KEGG   Sinorhizobium medicae: Smed_4573Help
Entry
Smed_4573         CDS       T00555                                 

Definition
(RefSeq) lipopolysaccharide biosynthesis protein
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzz GNVR CbiA AAA_26
Motif
Other DBs
NCBI-GeneID: 5318020
NCBI-ProteinID: YP_001313306
UniProt: A6UI93
Position
pSMED01:complement(1063988..1065976)
Genome map
AA seq 662 aa AA seqDB search
MTTFVPDGSLSARAHHRETVDFAAQQGGATVGLFDLWAIVKRRFWFLASIIFVCTLLSAI
ASFSIPKSYTASSEVVLERKDVRPFATDAALTSIDRDRSAAETEMDVLQSRKFAGRIVDR
LELVNDPTFNPYAPGGDKSSDQGLLRYVQDLIGVRRASTSARVIPDIKTQRDHAISALLS
QFEVSRTGESLAVRLIVTNQNPKLAQQIANTIASLYVEASLEFKQDERVADKQRALNTGG
AVAFLRQSMTQPLLITLRNEEARLLQSRAELAAKYGKNHPQMIDADSQIAGIRSMIEDEV
QRILSDLEAESLKPSARIVSTAELPNSPSFPKPGLIIPAALAGSTLLASVLALLLETTDT
RVRSGQRTTQLVRIPNLGYVPKVPKHLMSPGARRSSCIPDWSNVTSAEAERAVYMACRYS
DARQLRRVVMTTSCLHDVANASTAWGIATAAAADGRPTAFVNLDFNRHNISYLKNMERSP
ELIERYLRNRAALTEIVQSIPNLPGFGFIDATHVMTEPFRSLDSDSLCELIMDLKQSGYD
FIVLHAPPVLASGDATWLAPFVDGVVLLANWGKTTEEQLLEAAAQLRMNHAHLIGTVINQ
VNPEIHRRHHYGGFVITSKRIPAGRWHRDRGNGALQERPDAEVNTLTAPSARPSITRPSN
VA
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgacgacattcgttcccgatggcagcctatctgcccgcgctcaccaccgagaaactgtc
gatttcgccgctcagcagggcggggccacggtcggacttttcgatctctgggcgatagtc
aagcgacggttctggtttctcgcttcgatcattttcgtctgcacattgctgtccgcaatt
gcatctttctcgatccctaaatcctacacggccagctccgaagtggtgctggagcgaaag
gatgtccgtccgtttgcaaccgatgcggctttgacctccatcgatcgcgaccgatcggct
gcggaaaccgagatggacgtcttgcaatcgcgaaaattcgccggccgtatcgtggaccgg
ttggagctcgtcaatgatccaaccttcaacccttacgcaccgggcggcgacaaatcgagc
gaccaaggtctcctgcgatatgtccaggacctcatcggcgtccgccgtgcctctacatcc
gcgcgagtcatacctgatataaagacgcaacgggatcacgcgatctccgcgctgctgtct
cagttcgaggtgagcaggaccggcgaaagcctggcggtgaggcttatcgtaaccaatcag
aacccgaaactcgcacagcagatcgcgaatacgatcgccagcctgtacgtcgaggcgtcg
ctcgaattcaagcaggacgagcgggtcgcggacaagcaacgcgcactcaataccggtggt
gcggtggctttccttcgacagagcatgacgcagccgctcctgataaccttgcgcaacgaa
gaggcccgtctgctgcagagcagggccgagcttgctgccaagtacggcaaaaatcatcct
cagatgatcgatgcggattcccagatagccggcatccgcagcatgatcgaagacgaggtc
cagcgtattctctccgatctcgaggccgagtccctgaagcccagcgcacggatcgtatcg
acagcggagcttcccaattcaccctctttccccaaaccgggcctcatcataccagcggcc
ctcgccggttccacgctgctcgccagcgtattggcgctcctgctggaaaccaccgatacc
cgtgtccgaagcggacagcgcaccacccaactcgtgcggatacccaatctcggctatgtg
ccgaaagtcccgaagcatctgatgtcgccaggcgccaggcgctcctcatgtattccggat
tggagcaacgttacgtccgcggaagcagagcgggcggtttacatggcctgccgctattcg
gatgcgaggcagttacgccgagttgtcatgacgacatcctgcctccacgacgtcgccaac
gcttcaacggcctggggtattgcaacggccgcggcggcagatggtcgtcccacggccttc
gtgaatctcgatttcaaccgtcacaacatatcttatctgaagaacatggaacgttcgccg
gaactgatcgaacgctatctccgaaatcgcgccgctttgacggagatcgtacagtccatc
ccgaacttgcccggctttggcttcatcgacgcgacgcatgtaatgacagagcctttcaga
tcgctggactccgacagtctctgtgaactcattatggacctgaagcaaagcgggtatgac
ttcatcgtgctgcacgctccaccggtgctcgcgtccggcgatgcaacttggctggccccc
tttgttgacggcgtggtcctccttgccaattgggggaaaacgacggaagagcagctattg
gaagcagctgcccaactcaggatgaaccatgcgcatttgatcggcaccgtgatcaatcag
gtcaaccccgagatccatcggcgccaccactatggtggcttcgtcataacgtccaagcgc
attccggctggacgctggcatcgcgatcgcggcaacggggcactgcaagaacggccggac
gcggaggtaaacactttgaccgctccctcggcgagaccttcgatcacccgcccgtcgaac
gtcgcttaa

DBGET integrated database retrieval system