KEGG   Sinorhizobium medicae: Smed_4575Help
Entry
Smed_4575         CDS       T00555                                 

Definition
(RefSeq) group 1 glycosyl transferase
Organism
smd  Sinorhizobium medicae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 5318022
NCBI-ProteinID: YP_001313308
UniProt: A6UI95
Position
pSMED01:complement(1067657..1068898)
Genome map
AA seq 413 aa AA seqDB search
MVSSAAVDLRQSEAPGVSVGGHQAVVCFPFIGDLVGGSHMSSLGLIRNLPRDRFVPLVVL
HHTDGPVAELFRREGIGFVEAPVLNRLERAAPRNGAAVVNVVRTVPGLVKFLRARNASIV
HTNDGRTHLIWGLAARIAGSKHLWHHRGDATSFGLRHVAPWLPNRLVAVSKFASPRPGFF
SAAGKCSVVHSPFDVMKMDGFDRVEARNNVLAAIGCSPDTKLLGYVGTLVARKRPILFVE
AIAALKRLSPETKVAGLFFGDALNGLDEAARSRAEALGVADCIHFMGFRYPGEAWIAGLD
ALLVTAVNEPLGRTLVEAMLLRTPVIAADSGGNPEVVEDGRTGMLVPADDPDEFAKACLA
LFNNSGLCDHLVETARGEVRSRFSFERHVHAITSVYENLIGGTGMRRSASAGP
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggtatcgtctgcagcagttgatcttcgccaatcagaagcgcccggcgtaagcgttggc
ggccatcaggcggtcgtgtgctttcccttcatcggggacctcgttggcggaagccacatg
tcctcgcttggtctgatacgaaatctcccccgggatcgctttgtgccattggtcgtgctg
caccataccgatggaccggtcgcggaattgttccgccgggaaggcatcggcttcgtcgag
gctcccgttttgaaccgccttgagcgggccgctccgcgcaacggcgccgcagtggtcaat
gtcgtgcgcacggttccggggcttgtaaagtttctgcgggcaagaaatgcctcgatcgta
cacacgaatgatggccgcacgcatcttatctggggtcttgctgcgcggattgccgggtcg
aaacacctttggcaccatcggggcgacgctacttcgttcggtctgcgccatgtggccccc
tggctgcccaaccggctggttgccgtgtcgaaattcgcatcgccccggccgggatttttc
tcggccgcgggcaaatgcagcgtcgttcacagccccttcgatgtcatgaaaatggacggg
ttcgatcgagtggaagctcgcaacaacgtgctggccgcgatcggatgttcacccgacacc
aagctcctcggctatgtcggaacgctggttgcgcgcaaacggccgatcctcttcgtcgaa
gcgatagccgccttgaagcggctatcgcctgagaccaaagttgcgggcctgtttttcggc
gatgcgctcaatggcctggacgaagcggcgagatcccgcgccgaggcactgggggttgcc
gattgcattcacttcatgggcttccgttatccgggcgaagcctggatcgccggactggat
gccctgctggtaacggctgtgaatgaacctctcggaagaacacttgtcgaagcgatgttg
ctccgcacaccggttatcgcggccgactccggtgggaatccggaggtggtcgaagatggc
agaaccggaatgctcgttcccgcagacgacccggatgaattcgccaaggcttgcctggca
ctgttcaacaattccggactttgcgaccacctcgtggaaacggcgcgtggcgaggtccgc
tcccgtttcagtttcgaacgccacgtgcacgcaattacatcggtctacgaaaacctgatc
ggtggaaccggaatgcggcgctctgcaagtgcaggcccgtga

DBGET integrated database retrieval system