KEGG   Sinorhizobium medicae: Smed_4578Help
Entry
Smed_4578         CDS       T00555                                 

Definition
(RefSeq) polysaccharide export protein
  KO
K16552  polysaccharide biosynthesis/export protein ExoF
Organism
smd  Sinorhizobium medicae
Brite
KEGG Orthology (KO) [BR:smd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smd02000]
    Smed_4578
Transporters [BR:smd02000]
 Other Transporters
  Pores ion channels [TC:1]
   Smed_4578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Poly_export SLBB
Motif
Other DBs
NCBI-GeneID: 5318025
NCBI-ProteinID: YP_001313311
UniProt: A6UI98
Position
pSMED01:1071872..1073125
Genome map
AA seq 417 aa AA seqDB search
MGISPAVFGTILPRLMNGAFLLLMVLWVLACAMIGAMPARASDYRLNTGDVLTFDFLDDT
ELPVTATVSGEGEAQFPLIGAVGVVGLTVPEALERLRGEYRKREILVDPKISLDISTFRP
IFVLGEVKTPGSFPFYSGLTVEQAVGLAGGMQVVAANASDRIIARARLRGDIEGARAEIV
HEAIYAARLVAQLKSSDKIDLADVPEVARDYVTSVPLDGVVELEEKILKADLAANKSQAQ
ILTEGIAQAEGGIDILNQLVLQQKDVVQNSKEDVDRTATLRKRGLNTESDLSRAENNASA
EQAQLLETFATLARSRQEMSELKLQLAKLAADREKDILTQLQAREIAIKKLISQQHSAEE
QILLMTAVAEDESKKKQISYTYEIRRNPVGGTPASIKASPLTELVPGDVLTVAIAGM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggggatttcaccggccgttttcggaacgattttgccccgcttaatgaatggggcgttc
ctgctgctgatggttctatgggtgctcgcctgtgcgatgataggagcaatgccggctcga
gccagtgattaccggcttaacactggagatgttctgaccttcgacttccttgatgataca
gagttgccggtcaccgcgaccgtttcgggcgaaggcgaagcacaatttccgctcattggc
gccgtgggcgtcgtcgggctcacggtgccggaggcgctggagaggcttcgcggcgagtac
cgcaagcgcgaaattctcgtcgatccgaagatctctctcgatatatccaccttccggccg
atcttcgttctcggagaagtcaagacgccgggctcgtttcccttctacagcgggttgacg
gtcgagcaggccgtcggtctggcgggaggcatgcaggtggttgcggcaaacgcctcagac
aggatcatcgcacgggcgcgtttgcgcggggacatcgagggtgctcgcgccgagatcgtg
cacgaagccatctatgccgcgaggctcgtggcgcaattgaagtcctctgacaaaatcgac
ctcgccgacgtccccgaggtcgcgcgcgactatgtgaccagcgtgccgctcgatggtgtc
gtcgagctcgaagaaaagatcctgaaagccgaccttgcggccaacaagtcgcaggcgcag
atcctgaccgaaggtatcgctcaggccgagggtggaatagatattctgaaccaactggtt
ctgcagcaaaaggacgtggtgcagaacagcaaggaggatgtggaccgtaccgctaccttg
cgcaagcgcggcctgaatacagagagcgacctgtcgcgcgccgagaacaatgcctcggcc
gaacaggcgcagcttctcgagactttcgccacccttgcacggtcgcgtcaggaaatgagt
gaattgaagctgcaactggcgaagcttgcggccgaccgggagaaggatatcctgacccaa
ctccaggcgcgtgagatcgcgatcaaaaagctgatttcccaacagcactccgccgaagaa
caaattctcctcatgaccgctgtggccgaagacgagtcgaagaagaagcagatttcctat
acctacgagatccgtcgaaacccggttggcggcacgccggccagcataaaggcgtcgccc
ttgactgaactcgttcctggcgacgtgctgacggtggctattgccggaatgtaa

DBGET integrated database retrieval system