KEGG   Sinorhizobium medicae: Smed_5096Help
Entry
Smed_5096         CDS       T00555                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
smd  Sinorhizobium medicae
Pathway
smd00071  Fatty acid degradation
smd00072  Synthesis and degradation of ketone bodies
smd00280  Valine, leucine and isoleucine degradation
smd00310  Lysine degradation
smd00362  Benzoate degradation
smd00380  Tryptophan metabolism
smd00620  Pyruvate metabolism
smd00630  Glyoxylate and dicarboxylate metabolism
smd00640  Propanoate metabolism
smd00650  Butanoate metabolism
smd00900  Terpenoid backbone biosynthesis
smd01100  Metabolic pathways
smd01110  Biosynthesis of secondary metabolites
smd01120  Microbial metabolism in diverse environments
smd01130  Biosynthesis of antibiotics
smd01200  Carbon metabolism
smd01212  Fatty acid metabolism
smd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Smed_5096
   00630 Glyoxylate and dicarboxylate metabolism
    Smed_5096
   00640 Propanoate metabolism
    Smed_5096
   00650 Butanoate metabolism
    Smed_5096
  Lipid metabolism
   00071 Fatty acid degradation
    Smed_5096
   00072 Synthesis and degradation of ketone bodies
    Smed_5096
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Smed_5096
   00310 Lysine degradation
    Smed_5096
   00380 Tryptophan metabolism
    Smed_5096
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Smed_5096
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Smed_5096
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Smed_5096
Enzymes [BR:smd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Smed_5096
Exosome [BR:smd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smed_5096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 5319398
NCBI-ProteinID: YP_001313806
UniProt: A6UJP3
Position
pSMED02:complement(44227..45414)
Genome map
AA seq 395 aa AA seqDB search
MNNQDPVVIVGQARTPLGSFQGELKDFSAPDLGGAAIADALKRAGIAPDAVDEVVFGCVL
TAGQGQAPARQAALSAGLPLGVGATTVNKMCGSGMKAAMLAHDLIKAESASIVVAGGMES
MTNAPYLLDRARQGYRIGHQRALDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTRGAQD
DYAIGSLEKAKKAGADGSFANEIVPLSTGSGKGGTVSLDEQPQKARAEKIPLLKPAFREG
GTVTAANASSISDGAAALVLMRRSAAETQGVTPLAIVRGHATHADAPKLFPTAPIGAITA
LCQRIGWDIGGVDLFEINEAFAVVPMAAIRDLGLAAEKVNVNGGACALGHPIGASGARVI
VTLVNALRRRGLRRGIASVCIGGGEATAVAVEVSD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaccaggatccggtcgtcattgtcgggcaggctaggacgccgcttggcagcttt
cagggcgagcttaaagacttttccgcccccgatctcggcggtgccgcaatcgccgatgct
ctgaagcgcgccgggattgcgccggatgcggtcgatgaggtggtgttcggatgcgtcctg
accgcgggacaggggcaggcgccggcgcgtcaggccgcactcagcgcgggtcttccgctg
ggcgtcggcgcgacaaccgtgaacaagatgtgcggttcgggcatgaaggcagcgatgctg
gcgcacgacctgatcaaagcggaatccgcctcgatcgtggttgccggcggcatggaaagc
atgaccaatgcgccctatctgctcgaccgtgcgcggcagggctatcgcatcgggcatcag
agggctctcgaccacatgttcctcgatggcctggaggatgcttacgacaaggggcgcctg
atgggtacctttgccgaggattgcgccgaagcctatcagttcacccgtggcgctcaggac
gattatgcaatcgggtccctcgagaaagccaagaaggcaggtgccgatggcagctttgcc
aacgagatcgttccgctcagcaccggctcgggcaaggggggcactgtcagcctggacgag
caaccgcagaaggcgcgggccgagaaaatccccctgttgaagcccgcttttcgcgagggc
ggcacggtcacggctgcaaacgcgtcttcaatttcggatggcgcggcggcgctcgtgctg
atgaggcgatcggcagcggaaacacagggcgtcacacctctggcgatcgtccgcggtcat
gccacccatgctgatgccccaaagctctttccgacggcgccgatcggagcgatcactgca
ctctgccagcgcatcggctgggacatcggcggtgtcgacctcttcgaaatcaacgaggcc
tttgccgtcgtgccgatggcggcgatccgcgatctcggccttgccgcggaaaaagtgaac
gtcaatggcggtgcctgcgcattgggccatccgatcggagcctcgggcgcccgagtgatc
gtcacgctcgtcaatgcgttgcggcgccgtggcctgagacgcggcatcgcttctgtttgt
atcggcggcggcgaggcgacggccgttgccgtggaagtttcggactga

DBGET integrated database retrieval system