KEGG   Sinorhizobium medicae: Smed_5378
Entry
Smed_5378         CDS       T00555                                 
Name
(GenBank) Conjugal transfer TrbD family protein
  KO
K20529  type IV secretion system protein TrbD
Organism
smd  Sinorhizobium medicae
Pathway
smd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:smd00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smed_5378
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smd02044]
    Smed_5378
Secretion system [BR:smd02044]
 Type IV secretion system
  Trb secretion system protein
   Smed_5378
SSDB
Motif
Pfam: VirB3 TMEM210 Halogen_Hydrol
Other DBs
NCBI-ProteinID: ABR64147
UniProt: A6UKG7
Position
pSMED02:343901..344197
AA seq 98 aa
MSNSLGLQRNRVHRALSRPNLLMGADRELVLITGLAAVILIFVVLTIYSALFGVAVWIVI
VGFLRMMAKSDPLMRQVYLRHISYKPYYGATSSPWRRS
NT seq 297 nt   +upstreamnt  +downstreamnt
atgtctaattccctcggtctgcaacgcaaccgcgttcatcgcgcgctttcgcgcccgaac
ctcctgatgggcgcggaccgggagctggttttgatcaccgggcttgcggccgtgatcctg
atcttcgtcgtgcttacgatttattcggcgctcttcggtgtcgcagtctggatcgtgatc
gtgggctttctcaggatgatggcgaagtccgatccactgatgcgacaggtctatttacgg
cacatttcctacaaaccctactatggggcgactagttcgccgtggcgccgatcctga

DBGET integrated database retrieval system