KEGG   Sinorhizobium medicae: Smed_5379
Entry
Smed_5379         CDS       T00555                                 
Name
(GenBank) type IV secretion/conjugal transfer ATPase, VirB4 family
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
smd  Sinorhizobium medicae
Pathway
smd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:smd00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smed_5379
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smd02044]
    Smed_5379
Enzymes [BR:smd01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Smed_5379
Secretion system [BR:smd02044]
 Type IV secretion system
  Trb secretion system protein
   Smed_5379
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 AAA_10 DUF87 AAA_29 ABC_tran ATPase_2 AAA_23 AAA_16 AAA_21 FtsK_SpoIIIE T2SSE TrwB_AAD_bind CbiA
Other DBs
NCBI-ProteinID: ABR64148
UniProt: A6UKG8
Position
pSMED02:344208..346661
AA seq 817 aa
MVALKRFRATGPSFADLVPYAGLVDNGVLLLKDGSLMAGWYFAGPDCESATDLERNELSR
QINSVLSRLGSGWMIQVEAIRIPTVDYPSDDHCHFPDPVTRAIDAERRAHFAHTQGHFES
KHALILTYRPLESRKAALSKYIYSDEESRKKSYADTVLFVFKNAVREIEQYFANTLSIKR
METRETVKRGGERVARYDELLQFVRFCITGESHPVRLPDIPMYLDWLATAELEHGLTPKV
ENRFLGVVAIDGLPAESWPGILNSLDLMPLTYRWSSRFIFLDAEEARAKLERTRKKWQQK
VRPFFDQLFQTQSRSVDQDAMLMVAETEDAIAQASSQLVAYGYYTPVVVLFDDDRNTLQE
KAESVRRLVQAEGFGARIETLNATDAYLGSLPGNWYCNIREPLINTSNLADLIPLNSVWS
GNAVAPCPYYPPNSPPLMQVASGSTPFRLNLHVDDVGHTLVFGPTGSGKSTLLALIAAQF
RRYDRAQIFAFDKGNSLLSLTLAAGGYHYDLCGDDAEERNALAFCPLSELKSDADRAWAT
EWIEMLIALQGVIITPDHRNAISHQVSLMASATGRSLSDFVSGVQMREIKDALHHYTVDG
PMGQLLDAEEDGLTLGALQTFEIEQLMNMGERNLVPVLTYIFRRIEKRLDGSPSLIILDE
AWLMLGHPIFRSKIREWLKVLRKANCAVVLATQSISDAERSGIIDVLKESCPTKICLPNG
AAREPGTREFYERIGFNERQIEIVSIAIPKREYYVATPEGRRLFEMALGPVALSFVGASG
KEDLKRIRALKSEHGRDWPIHWLETRGVQDAAAILKK
NT seq 2454 nt   +upstreamnt  +downstreamnt
atggtagccctcaaacgtttccgtgcgaccggtccgtccttcgccgatctggtcccttat
gccggcctggtcgataatggcgttctcctcctgaaggacggaagcctgatggccggctgg
tactttgctggaccggactgcgaaagcgccactgacctcgaacgcaatgaactatcgagg
cagatcaattcggtcctgtcgcgccttggaagtgggtggatgattcaggtcgaggcgatc
cgcattccgacagtcgactatccatctgacgaccactgccatttccctgacccggtaacg
cgtgcgatcgatgccgagcgccgcgcgcacttcgcacacacgcaggggcacttcgagagc
aagcacgcgctaatactgacctatagaccgcttgagtcgaggaaggctgctcttagcaaa
tacatctactcggatgaggagagccgcaagaagtcctacgcggacacggtactatttgtc
ttcaagaacgccgtccgcgagatcgagcagtatttcgcgaacacgctttcgatcaagcga
atggaaacgcgcgaaacggttaagaggggcggggagcgggttgcccggtatgacgagttg
ctccagttcgtgcggttctgcataacaggcgagagtcaccccgtccgcttgccggatatt
ccgatgtatctagactggcttgcgaccgccgagcttgaacacgggctgacgccgaaggtt
gagaaccgcttccttggcgtcgttgctatagacggcctgccggcggaaagctggccaggg
atcctgaacagtcttgacctgatgccgctcacctaccgatggtcatcgcgcttcatcttt
ctcgatgccgaagaagcccgggcgaagctcgaacgcacacgcaagaaatggcagcagaag
gtgcggccgtttttcgaccagctgtttcagacgcaaagccgctcggtggatcaggacgcc
atgctgatggtggccgagactgaggatgccatcgcccaagcctcgtcgcagctggtcgcc
tatggctactacacgcctgtggtcgtgctgttcgatgacgatcggaacacgctgcaggag
aaggccgaatctgtgcgccgactggttcaggccgaaggatttggtgcgagaattgagaca
ctcaacgcgaccgacgcttatctcggcagcctgccgggcaactggtactgcaacatccgt
gaaccgctgatcaacaccagtaacttagctgatctcattcctctcaattcggtctggtcc
ggcaacgccgttgcaccatgcccctactatccgccgaactcgcccccactgatgcaggtc
gccagcggttccacgccatttcggctgaacctgcacgtcgatgatgtcggccatacgctg
gtcttcggcccgacggggtcaggcaaatctacgctgctggcgctgatagcggcgcagttt
cgccgttatgaccgcgcccagatctttgcttttgacaaagggaattcgctgctttctcta
acgcttgcagcgggtggctatcactatgatctctgcggcgacgatgcggaagagaggaac
gctctggccttctgccctctatccgaactgaaaagtgacgctgatcgggcgtgggcgacg
gaatggatcgagatgctgatcgccctgcagggcgtcatcatcacccccgaccatcgcaat
gccatttcccatcaagtctcacttatggccagcgcgacggggcgctcgctgtcggatttc
gttagcggcgttcagatgcgcgagattaaggacgcacttcatcactacaccgtcgacggt
ccgatgggccagttacttgatgctgaagaggatgggctgacgcttggcgccttgcaaact
ttcgaaatcgagcagctcatgaacatgggtgagcgcaacctggtgcctgtgctcacctat
atcttccgccggatcgagaaacgcctcgatggctcgccaagcctgatcattttggatgaa
gcatggctcatgctcggccatccgattttccgtagcaagatccgcgagtggctgaaagtg
cttcgcaaggcgaattgcgccgtggtgcttgctacgcagtcgatctcggacgctgagcgc
tccggcatcattgatgtgctcaaggaatcctgccccacaaagatctgccttccaaacggc
gctgctcgggagccggggacgcgcgagttctacgaacggatcggcttcaacgaaagacag
attgagatcgtttcgatcgccattccgaagcgagagtactacgtcgccactccggaaggc
cgacggcttttcgaaatggctcttggtcccgtggcactcagtttcgtgggggcatcgggg
aaagaggatttgaagcgcatccgcgcactcaaatccgagcatggccgcgattggccaatc
cactggcttgaaacgagaggagttcaagatgccgcagcgatactcaaaaaatag

DBGET integrated database retrieval system