KEGG   Sinorhizobium medicae: Smed_5385Help
Entry
Smed_5385         CDS       T00555                                 

Definition
(RefSeq) conjugal transfer protein TrbH
  KO
K20267  type IV secretion system protein TrbH
Organism
smd  Sinorhizobium medicae
Pathway
smd02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:smd00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smed_5385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smd02044]
    Smed_5385
Secretion system [BR:smd02044]
 Type IV secretion system
  Trb secretion system protein
   Smed_5385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MLTD_N TrbH
Motif
Other DBs
NCBI-GeneID: 5319687
NCBI-ProteinID: YP_001314087
UniProt: A6UKH4
Position
pSMED02:350308..350748
Genome map
AA seq 146 aa AA seqDB search
MQNLLSTVIAAALLSGCQTADQGLRPSSDAGAVTGPAASAIAGDMVSRLAEQIGPATATT
TIRMDKDTSEFAIALEAALKGWGYTVVTDKKLVRGIKPVELAYAAESFDGQILARLSTPS
IAFGRAYTPTGAGAMPASPLSILQRN
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatcttctttcgactgtgattgccgccgcgcttttgtctggttgtcaaacggcg
gatcagggcttgcgtcccagctcagatgcgggagcagtcaccggaccggccgcgagcgcc
atcgccggcgacatggtgagccgtcttgccgagcaaatcggccctgccacagctacgaca
acaatcagaatggacaaggatacctccgagttcgcgatagccctcgaagcagccttaaag
gggtggggctacacggtcgtcaccgacaagaaattggtcaggggcatcaagcccgtcgag
cttgcatatgcagccgagagcttcgacggacagattctggctcgactctcgacgccttcc
attgcgttcgggcgagcttacacgccgactggggccggcgccatgcccgctagtccgctg
tcgatcttgcagcgcaactga

DBGET integrated database retrieval system