KEGG   Sinorhizobium medicae: Smed_6152Help
Entry
Smed_6152         CDS       T00555                                 

Definition
(RefSeq) type IV secretion system protein VirB11
  KO
K03196  type IV secretion system protein VirB11 [EC:7.4.2.8]
Organism
smd  Sinorhizobium medicae
Pathway
smd03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:smd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Smed_6152
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smd02044]
    Smed_6152
Enzymes [BR:smd01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Smed_6152
Secretion system [BR:smd02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Smed_6152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSE AAA_7 Mg_chelatase AAA_16 ABC_tran AAA_22 RsgA_GTPase AAA_33 Zeta_toxin Gtr1_RagA FtsK_SpoIIIE TsaE DEAD AAA_29 TrwB_AAD_bind AAA_30 DUF2066 RNA_helicase NB-ARC Sigma54_activat AAA_2 Septin Kinesin ATPase
Motif
Other DBs
NCBI-GeneID: 5320454
NCBI-ProteinID: YP_001314711
UniProt: A6UM98
Position
pSMED02:complement(1077566..1078606)
Genome map
AA seq 346 aa AA seqDB search
MQTEADPQLRLLLKPVLEWLEDPRTEEVAINRPGEAFVRQAGAFTKHPLSLTYDDLEDIA
ILAGALRKQDVGPRSPLCATELPGGERLQICLPPAVQSGTVSLTIRRPSSRVSELKEVSS
RYDASRWNQWRFRQERQTQQDMQILEHYARGNLEEFLQACVTGRLTMLLCGHTGSGKTTM
SKTLINAIPPQERLITIEDTLELVIPHENHVRLLYSKDGAGVGGVTAEQLLQASLRMRPD
RILLGEMRDDAAWAYLSEVVSGHPGSISTIHGADAVQGFKKLFSLVKSSPQGAAIEDRTL
IDMLSAAIDVIVPFRTYGDVYEVGEIWLAADARRRGETVAGLLDQH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgaggcagatcctcaactgcgtttgctcctcaaaccagtactagaatggctt
gaggacccaaggaccgaagaggtcgcgattaatagaccaggagaggctttcgtccggcaa
gccggagcgtttacgaaacatcctctatctctgacctatgacgatctcgaagatatcgcg
atcttagcgggagcgctacgaaagcaagatgttggaccacgaagccctctctgcgccacc
gagttgccaggcggagagcggctgcagatttgtttaccgccagcagttcagtcaggtacc
gtcagcctgacgatccgccgcccatcttctcgcgtttcggaacttaaggaagtctcatct
cgctatgacgcttcgcgctggaatcaatggcgcttccgccaggagcgccaaacgcaacag
gatatgcagatccttgagcattacgcccgcggtaatttggaagaattcctgcaagcgtgc
gtgactgggcggctgacgatgctgctttgcggccacacgggtagcggcaagacgacgatg
agcaagactttgattaacgccattccgccgcaggaaaggctgatcaccatagaggacacg
ctcgagctcgtgattccacatgagaatcatgtccggctactttattcgaaggatggggca
ggagtaggtggggtgaccgcggagcagcttctacaagccagtctccgcatgcggccggac
cgaatactgctcggcgagatgcgcgacgatgccgcttgggcatatctcagcgaagtggta
tctggccatccaggatcaatctcgactattcacggagccgatgccgtccaaggtttcaag
aagctcttttcgctcgtcaagagcagcccacaaggagctgccatagaggaccgtacgctg
attgacatgctatcggcggccatcgatgtcatcgtgccgttccggacctacggtgacgtc
tacgaagttggcgagatttggctggcggccgacgcgcgtcgacgcggagaaacagtcgct
ggtcttctggaccagcattag

DBGET integrated database retrieval system