KEGG   Sinorhizobium medicae: Smed_6323Help
Entry
Smed_6323         CDS       T00555                                 

Definition
(RefSeq) cytochrome c class I
  KO
K08738  cytochrome c
Organism
smd  Sinorhizobium medicae
Pathway
smd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Smed_6323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Nudix_N_2
Motif
Other DBs
NCBI-GeneID: 5320625
NCBI-ProteinID: YP_001314853
UniProt: A6UMP0
Position
pSMED02:1237675..1238067
Genome map
AA seq 130 aa AA seqDB search
MKCATMFSTAILGLLLCSSIASAQEHAGPDGERLFRSRCGSCHGLNTGENRVGPHLFGVF
GRAAGSVAGARYSNALRTSGFVWDEERLHAYLNNPRQVVPGTTMSASVRDQAQRSAIITY
LQSLSAEPPN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgcgcaaccatgttctcgaccgccatcctcggtctgcttctctgttccagtata
gcctcggctcaggagcatgccggccccgatggcgagaggcttttccgcagccgttgtggc
tcctgtcacggcctgaacacgggtgaaaaccgcgtcgggccgcaccttttcggggttttc
gggcgtgctgcaggcagtgttgcgggcgctcgctactcgaacgcgctccgcacgtccggc
ttcgtctgggacgaggaacgcctccacgcctatctgaacaatcctcgtcaggtcgtgccg
ggtactaccatgagcgccagcgttcgcgaccaggctcaacgctcggccatcatcacatat
ctgcaaagcctttcggcggagccgcccaactag

DBGET integrated database retrieval system