KEGG   Sinorhizobium meliloti 1021: SM_b20014
Entry
SM_b20014         CDS       T00058                                 
Name
(GenBank) probable transcriptional regulator
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
sme  Sinorhizobium meliloti 1021
Brite
KEGG Orthology (KO) [BR:sme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sme03000]
    SM_b20014
Transcription factors [BR:sme03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    SM_b20014
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_23 HTH_24 HTH_IclR HTH_3 MarR HTH_11 TetR_N
Other DBs
NCBI-ProteinID: CAC48417
RhizoBase: SM_b20014
UniProt: Q92XE5
Position
pSymB:complement(20377..21378)
AA seq 333 aa
MRDRPKIKDIAEKAGVSVATVSRALAASTLVTAETRQRVLDLARELDYRPNVSARNLRTR
RSMTVLMVVRDVGNPFYLDILKGVEATAREAGYAVLMGNTENDPARETEYFSMLRDGHAD
GMILMTGKLPSAGDWNHLPVVVALEMIEGSGLPHVQVDNVAAARGAVQHLISLGHRRIAH
ISGPVPEPMSVYRREGFRLAMRDAGLTIPAGYEVRGDFLIESGEECCRSLFSLSDPPTAL
FVANDEMAYGAVHELRRIGRDVPGDVSVVGFDDLYLSKAFYPPLTTVGQPRSEIGRTAMA
VLLGILAGGSEVAEPIVLPTVLKVRGSTAPPLI
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgagggaccggccgaagatcaaggacatcgccgagaaggcgggcgtgtcggtggccacc
gtctcgcgcgcccttgccgcttcgacgctggtgaccgccgagacgcgccagcgcgtgctc
gacctggcgcgcgagctcgattaccgtccgaatgtcagcgcccgaaatctgcgcacccgc
aggtccatgacggtgctgatggtcgtgcgcgatgtcggcaatcccttctacctcgacatc
ctcaagggcgtcgaggcgacggcgcgcgaagccggctatgccgtgctgatgggcaatacg
gagaacgacccggcccgcgagaccgagtatttcagcatgctgcgcgacggacatgccgac
ggcatgatcctgatgaccggaaagctgccgtccgccggcgactggaaccatctgcccgtg
gtggtggcgctggaaatgatcgagggctcgggcctgccgcatgtgcaggtcgacaacgtc
gccgcggcccgcggggccgtccagcatctgatttcactcggccatcggaggatcgctcat
atatccgggccggttcccgagccgatgagcgtctatcggcgggaggggtttcgcctggcg
atgcgcgatgccgggctgacgattccagccggctacgaggtgcggggcgacttcctgatc
gaaagcggcgaggaatgctgccgctcgctcttctctctttcagatccgccgacggcgctt
ttcgtcgccaatgacgaaatggcctatggcgccgtccacgaattgagacgaatcggacgc
gacgtgccgggcgacgtgtcggtcgtcggcttcgacgatctctatctgagcaaggccttc
tatccgccgctgacgacggtcggccagccgcgctccgagatcggccgcaccgccatggcg
gtgctccttggaattctggcgggcggctcggaggtggccgaaccgatcgtgctgcccacg
gttctgaaagtccgaggcagcacggcgccgccacttatctga

DBGET integrated database retrieval system