KEGG   Sinorhizobium meliloti 1021: SM_b20113Help
Entry
SM_b20113         CDS       T00058                                 

Definition
(RefSeq) dehydrogenase
Organism
sme  Sinorhizobium meliloti 1021
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ThiF NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 1236404
NCBI-ProteinID: NP_436653
RhizoBase: SM_b20113
UniProt: Q92X49
Position
pSymB:complement(124709..125641)
Genome map
AA seq 310 aa AA seqDB search
MTMLRDITILQAAELPEKTDLELKETFNTVRLPRDASAIGPFLSEYGARIRGIAVRHAHI
DAAMLDRLPALEIISSYSAGLDGIDVETAHARGVVVRNTSKILAEDVADLALALSISATR
GLMRGHDFVREGKWGESAFPLGRSLRSMKTGIVGLGHIGSAVAARLSVMGAPTAYYGPRR
KPVDLPYFDGIGALAAWADLLIVTCPASPETIGLVNAAVLASLGSEGYLVNVSRGTIVDE
QALITALAGNGIAGVALDVFEKEPFVPEALRTDPRVVLSPHMGSGTRETRQQMGDSMVAA
LVEHFESRSA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgctccgggacatcaccatccttcaggccgccgagctgccggaaaagaccgat
ctggaactgaaggaaaccttcaataccgtccggctgccgagggatgcctcggcgatcggg
ccgtttctttccgagtacggagcgcgtattcgcggcatcgccgtcaggcacgcccatatc
gatgcggccatgctcgaccgcctgccggcgctggagatcatctccagctacagcgccggt
ctcgacggcatcgatgtcgagaccgcgcatgcccgtggcgtcgtcgtccgcaacacgtcg
aagatccttgccgaggatgtcgccgatcttgcgcttgcactgagcatttcggccacgcgc
ggcctcatgcgcggccacgatttcgtgcgcgagggcaagtggggcgagagcgccttcccg
ctcggccgctcgctgagatcgatgaagacggggatcgtcgggcttggacatatcggctcg
gcggtcgccgcccggctgagcgtgatgggagcgccgaccgcctattacggcccgagacgg
aagcctgtcgaccttccctacttcgacggcatcggggcgctcgcggcctgggccgatctc
ctgatcgtcacctgtcctgcgagtcccgagacgatcggcctcgtcaatgccgccgtgctc
gcgagccttggctcggaaggctatctggtgaacgtctcgcgcggcacgatcgtcgacgaa
caggcgctcatcacggcgctggccggaaacgggatcgccggcgtggccctcgacgtcttt
gagaaggagcccttcgtcccggaagcgctccgcaccgacccgcgcgtcgtcctgtcgccg
cacatgggtagcggcacgcgcgagacgcggcaacagatgggcgacagcatggtcgccgca
ttggtggagcatttcgagagccgaagcgcgtga

DBGET integrated database retrieval system