KEGG   Sinorhizobium meliloti 1021: SM_b20262Help
Entry
SM_b20262         CDS       T00058                                 

Definition
(RefSeq) semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00040  Pentose and glucuronate interconversions
sme00053  Ascorbate and aldarate metabolism
sme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SM_b20262
   00053 Ascorbate and aldarate metabolism
    SM_b20262
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     SM_b20262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 1236583
NCBI-ProteinID: NP_436792
RhizoBase: SM_b20262
UniProt: Q92WS7
Structure
PDB: 

Position
pSymB:266814..268331
Genome map
AA seq 505 aa AA seqDB search
MIFTPKGKHLVAGEWLDGAGTFASAPAHGPAHDFAVGTVELVNRACEAAEEAFWTYGYSS
RKERAAFLRAIADEIEARAEAITEIGSQETGLPEARLNGERGRTTGQLRLFADHIEKGDY
LDRRVDAAMPERQPAPRQEIRLVQRPVGPVAVFGASNFPLAFSTAGGDTAAALAAGCPVV
VKGHSAHPGTGEIVAEAVDAAIRKTGVHPGVFSLIQGGSRDVGHALVQHPHIKAVGFTGS
LAGGRALFDLCAARPEPIPFFGELGSVNPMFLLPEALKARAETLGQGWAGSLTMGAGQFC
TNPGIAVVIEGADADRFTTAAVEALAKVAPQTMLTDGIAKAYRDGQARFATRNAVKPLLA
TESSGRDASPNLFETTGAQFLADHALGEEVFGPLGLVVRVGSPAEMEELARGFQGQLTAT
IHMDAGDLETARRLRPVLERKAGRVLVNGFPTGVEVVDSMVHGGPYPASTNFGATSVGTM
SIRRFLRPVAYQNMPEDLLPEDFLG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgattttcacccccaaaggaaaacacctcgtcgcgggcgaatggctcgatggggcaggc
accttcgcttcggcgccggcgcatggcccggcgcatgattttgccgtaggcaccgtagag
ctggtgaaccgggcctgcgaggcggctgaggaagccttctggacctatggctattcctcg
cgcaaggagcgcgccgccttccttcgcgccatcgccgacgagatcgaggcccgggcggag
gcgattaccgagatcggcagccaggaaaccggcctgcccgaggcgcggctcaacggcgaa
cggggccgcacgaccggccagctcaggctctttgccgatcatatcgaaaagggtgattat
ctcgaccggcgcgtcgatgcggcgatgcccgagcgccagccggcgccccgtcaggagata
cggctggtccagcgccccgtcggtccggtcgccgtcttcggcgcctcgaatttcccgctg
gccttttcgaccgccggcggcgatacggccgcggcgctcgcagccggctgcccggtcgtg
gtaaagggtcattcggcgcatcccggcaccggcgagatcgtcgccgaggccgtcgacgca
gcgatccgcaagacgggtgttcatcccggcgtattctcgctgatccagggcggcagccgc
gacgtcggtcatgcgctggtgcagcatccccatatcaaggccgtaggcttcaccggttcg
ctcgccggcggacgtgccctgttcgatctttgcgcggcgcgccccgaaccgatcccgttc
ttcggcgaactcggttcggtcaacccgatgttcctgctgccggaagcgttgaaggcacgg
gcggaaacgctggggcagggatgggccggttcgctcaccatgggcgccgggcagttctgc
accaatcccggaatcgccgtcgtcatcgaaggtgcggacgccgaccgcttcaccaccgcc
gccgtcgaggcgcttgccaaggtggcaccgcaaaccatgctgacggacggtatcgccaag
gcctaccgcgacggtcaggcgcgctttgcgacgcgcaacgccgtcaaaccgctgcttgcg
accgagtcgtccggccgtgacgcatcgcccaatctcttcgagacgacgggtgcccagttc
ctggccgaccatgcgctcggcgaagaagtgttcggcccgcttggactggtggttcgggtg
ggatcgccggccgaaatggaagagctcgcgcgcggcttccagggccagctgaccgcaacc
atccatatggatgcgggcgatctggagacggcgcgccgtctgcgtccggtgctcgagcgc
aaggcgggccgggtgctggtcaacggcttcccgaccggggttgaagtcgtggattcgatg
gtgcatggaggcccctatccagcctcgaccaacttcggcgcaaccagcgtcggcaccatg
tcgattcgacgtttcctgcgtcccgtcgcttaccagaacatgccggaagacctgctgccc
gaggacttcctcggctga

DBGET integrated database retrieval system