KEGG   Sinorhizobium meliloti 1021: SM_b20299Help
Entry
SM_b20299         CDS       T00058                                 

Gene name
nanA
Definition
(RefSeq) N-acetylneuraminate lyase
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00520  Amino sugar and nucleotide sugar metabolism
sme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SM_b20299 (nanA)
Enzymes [BR:sme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     SM_b20299 (nanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-GeneID: 1236620
NCBI-ProteinID: NP_436829
RhizoBase: SM_b20299
UniProt: Q92WP0
Position
pSymB:305696..306595
Genome map
AA seq 299 aa AA seqDB search
MKLEGIYSALLTPFSEDESIDRQAIGALVDFQVRLGIDGVYVGGSSGEAMLQSLDERADY
LSDVAAAASGRLTLIAHVGTIATRDALRLSQHAAKSGYQAISAIPPFYYDFSRPEVMAHY
RELADVSALPLIVYNFPARTSGFTLPELVELLSHPNIIGIKHTSSDMFQLERIRHAVPDA
IVYNGYDEMCLAGFAMGAQGAIGTTYNFMGDLFVALRDCAAAGRIEEARRLQAMANRVIQ
VLIKVGVMPGSKALLGIMGLPGGPSRRPFRKVEEADLAALREAVAPVLAWRESTSRKSM
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaagggatctattcggccctccttaccccgttctccgaagacgaaagcatt
gaccggcaggccatcggggcgctcgtcgattttcaggtccgtctcggcatcgacggggtc
tatgtcggcggcagctcgggcgaagcgatgctgcagtcgctcgacgagcgcgcggactac
ctctccgacgttgccgccgccgcgtccggccgcctgacgctgatcgctcatgtcggcacg
atcgcgacgagagatgcgctcaggctttcgcagcatgcggccaaatcgggttaccaggcg
atttcggcgatcccgcccttctactacgacttctcccggcccgaagtcatggcgcattat
cgggagctcgccgatgtttcggccctgcctctcatcgtctataacttcccggcccgcacc
agcggcttcaccttgcccgaactggtcgagcttctctcgcatcccaacatcatcggcatc
aagcatacgtcgagcgacatgttccagctcgaacgcatccggcatgcagtacccgacgcc
atcgtatacaacggctatgatgaaatgtgcctggccggtttcgcgatgggcgcacagggt
gcgataggcaccacgtataatttcatgggcgatctgttcgtcgcgctcagggactgcgca
gcggccgggcggatcgaggaggcccggcggctgcaggccatggcgaaccgcgtgatccag
gtgctgatcaaggtcggcgtcatgccggggtccaaggcgctgctcggcatcatgggcctt
cccggaggcccctccagacgccccttccggaaggtcgaagaggcggatctcgcagccctt
cgcgaagccgtggcgccggtcctcgcgtggcgcgagagcacttccagaaaaagcatgtaa

DBGET integrated database retrieval system