KEGG   Sinorhizobium meliloti 1021: SM_b20325
Entry
SM_b20325         CDS       T00058                                 

Gene name
thuE
Definition
(RefSeq) trehalosemaltose-binding protein
  KO
K10236  trehalose/maltose transport system substrate-binding protein
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SM_b20325 (thuE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SM_b20325 (thuE)
Transporters [BR:sme02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Trehalose/maltose transporter
    SM_b20325 (thuE)
SSDB
Motif
Pfam: SBP_bac_1 SBP_bac_8 SBP_bac_11 Glyco_transf_29
Other DBs
NCBI-GeneID: 1236642
NCBI-ProteinID: NP_436851
RhizoBase: SM_b20325
UniProt: Q7ANS2
Position
pSymB:328098..329369
AA seq 423 aa
MNVKPFVRTLISCAAIAGAIDLAAAAELSMAANSTGKNLSFLRDQIARFEKETGHKVNLV
TMPASSSEQFSQYRLWLAAGNKDVDVYQTDVIWAPQLAEQFVDLTEATKDVVGEHFPSII
QSQTVNGKLVALPFYTDAPALYYRKDLLDKYGKTPPKTWDELAATAKEVQDKERAAGSAD
IWGFVFQGNAYEGLTCNALEWIKSSGGGQIIEPDGTISVNNEKAAAAVEKVKEWIGTIAP
KGVLAYQEEESRGVWQTGNAVFMRNWPYAYALGNGDDSAVKGKFEVAPLPAATDGDQPSS
TLGGWNLAVSKYSDEQEAAIAFVKFLGSAETQKVRAIELSNLPTIAALYDDPEVAAAQPF
MPHWKPIFQSAVPRPSAVAKVKYNEVSSKFWSAVHNTLSGNGTAAENLELLEVELTELKG
DAW
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgaacgtgaagccttttgtaaggacgctgatttcctgcgccgcgatcgccggcgcaatc
gaccttgctgccgccgccgaattgtctatggcggccaattcgaccggcaagaatctgagt
tttctgcgggaccagatcgccaggttcgagaaggagacgggtcacaaggtcaacctggtg
accatgccggcttcgagcagcgagcagttcagccagtatcgactctggcttgccgccggg
aacaaggatgtcgatgtctaccagacggacgtcatctgggctccgcagctcgccgagcag
ttcgtcgacctgaccgaggcgacgaaggacgtggtcggcgagcacttcccttcgatcatc
cagtcgcagacggtcaacggcaagctggtcgctctgcccttctacaccgacgcgccggcg
ctttattaccgcaaagacctgctcgacaaatacggcaagacgccacccaagacctgggat
gaactggcggcgacggcgaaggaggttcaggacaaggagcgtgccgccggcagtgccgat
atctggggcttcgtctttcagggcaatgcctatgaggggctcacctgcaacgcgctcgag
tggatcaagtcgtccggcggcggtcagatcatcgagcccgacggcacgatctccgtcaac
aacgaaaaggcggcggcggccgtcgagaaagtcaaggaatggatcggcacgatcgcgccc
aagggcgtgcttgcctatcaggaggaggaatcacgcggcgtctggcagaccggcaacgcc
gttttcatgcgtaactggccctatgcctacgcccttggcaacggggacgacagcgccgta
aagggcaaattcgaagtggccccgcttccggccgccaccgacggcgatcagccgtcctcg
acactcggcggatggaacctcgcggtctcgaaatattccgacgagcaggaggcggcgatc
gccttcgtcaagttcctgggctcggccgaaacccagaaggtgcgtgcgatcgagctttcg
aaccttccgacgatcgcggcgctttacgacgacccggaagtcgcggcggcccagccgttc
atgccgcattggaagcctatcttccagagcgccgtgccgcgcccctcggccgtggcaaag
gtgaagtacaacgaagtgtcctccaagttctggagcgccgtgcacaacacgctttcgggt
aacggaacggcggcggagaatctcgagcttctcgaagtcgaactgaccgaactcaagggc
gacgcttggtaa

DBGET integrated database retrieval system