KEGG   Sinorhizobium meliloti 1021: SM_b20327
Entry
SM_b20327         CDS       T00058                                 

Gene name
thuG
Definition
(RefSeq) trehalosemaltose transporter permease
  KO
K10238  trehalose/maltose transport system permease protein
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SM_b20327 (thuG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SM_b20327 (thuG)
Transporters [BR:sme02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Trehalose/maltose transporter
    SM_b20327 (thuG)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-GeneID: 1236644
NCBI-ProteinID: NP_436853
RhizoBase: SM_b20327
UniProt: Q7ANS0
Position
pSymB:330443..331273
AA seq 276 aa
MVVAIAKRTAFYALVAVIILVAVFPFYYAILTSLKSGTALFRIDYWPTDISLANYAGIFS
HGTFVRNLGNSLLVATLVVAISLLLAVTAAYALARVRFRGRGLLLLTILSVSMFPQIAVL
AGLFELIRFVGIFNTPLALIFSYMIFTLPFTVWVLTTFMRDLPIEIEEAAIVDGASPWVV
ITRVFMPLMWPALVTTGLLAFIAAWNEFLFALTFTSSNTQRTVPVAIALLSGGSQFEIPW
GNIMAASVIVTVPLVVLVLIFQRRIISGLTAGGVKG
NT seq 831 nt   +upstreamnt  +downstreamnt
atggtcgtcgcgatcgcaaagcggacggcgttttatgcgctggttgccgtcatcatcctc
gtcgccgtctttcccttctattacgcgatcctgacgagcctgaagtccggcacggcactg
ttccgcatcgactactggccgacggatatttcgctcgccaattatgcaggcatcttttcg
cacgggaccttcgtgcgcaatctcggcaattcgctcctcgtcgccacgctcgtggttgcc
atatcgctgcttcttgccgtaaccgcagcctatgcgcttgcccgggtacgcttccgcggt
cgcgggctgcttctcctgacgatcctgtcggtctcgatgttcccgcagatcgccgttctt
gcaggtctcttcgagctcatccgcttcgtcgggatcttcaacacgccgctcgcgctcatc
ttttcctacatgatcttcacgctgccgttcacggtctgggtgctgaccaccttcatgcgg
gatctgccgatcgagatcgaagaagcggcgatcgtcgacggcgcttctccctgggtggtg
atcactcgtgtcttcatgccgctgatgtggccggcgcttgtgacaaccgggcttctcgcc
ttcatcgcggcgtggaacgagttcctcttcgcactgacattcacctcgtcgaacacgcag
cgcaccgtgccggtcgcgatcgctctgctttcaggcggcagccagttcgagatcccctgg
ggcaacatcatggcggcatccgtgatcgtcaccgtgcctctcgtggtcctcgtgctcatc
tttcagcggcggatcatttccggtctcacggccggcggcgtcaaaggatag

DBGET integrated database retrieval system