KEGG   Sinorhizobium meliloti 1021: SM_b20328
Entry
SM_b20328         CDS       T00058                                 
Symbol
thuK
Name
(GenBank) ThuK ABC transporter, ATP-binding protein
  KO
K10111  multiple sugar transport system ATP-binding protein [EC:7.5.2.-]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SM_b20328 (thuK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SM_b20328 (thuK)
Transporters [BR:sme02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter
    SM_b20328 (thuK)
   Arabinogalactan oligomer/maltooligosaccharide transport system
    SM_b20328 (thuK)
   Trehalose/maltose transporter
    SM_b20328 (thuK)
   Putative sorbitol/mannitol transporter
    SM_b20328 (thuK)
   Putative multiple sugar transporter
    SM_b20328 (thuK)
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_21 TOBE RsgA_GTPase AAA_29 AAA_16 AAA_22 Rad17 AAA_23 AAA_33 OB_MalK AAA AAA_15 AAA_28 NB-ARC MMR_HSR1 AAA_30 ATPase_2 AAA_25 AAA_18 NACHT MetW AAA_5 RNA_helicase
Other DBs
NCBI-ProteinID: CAC48714
RhizoBase: SM_b20328
UniProt: Q7ANR9
Position
pSymB:331283..332311
AA seq 342 aa
MAELQLRDIRKSFGAFDVIKGVSMEIKPGEFMVFVGPSGCGKSTLLRLIAGLEEITSGTL
AFDGQIVNQLTPSRRGIAMVFQSYALYPHMTVYENMAFGMQLAGKDKQQCRKRVEAAAEM
LQLTPYLERLPRQLSGGQRQRVAIGRAIVRDPKVFLFDEPLSNLDAALRVATRLEIAKLH
RSMHKTTMIYVTHDQVEAMTLADRICVLRDGLVEQIGTPLELYETPNSVFVAGFIGSPKM
NFLSGAFAEPYKADTIGIRAEHLEIDEQGGEWSGTVIHSEMLGSDSYIYLDIGTGEPVIV
RESGIAKHQPGQTIRISPAAGQVHRFDAGGRALGRMQMRGAA
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggcagagcttcaattgcgcgatatccgcaaatccttcggcgccttcgatgtgatcaag
ggcgtcagcatggaaatcaagccgggcgagttcatggtcttcgtcggcccttccggctgc
ggcaagtcgaccctcctgagactgatcgccgggctcgaggaaatcacctccggaacactt
gccttcgacggccagatcgtcaatcagctgacgccttcgcgccgcggcatcgccatggtc
tttcagtcctatgcgctctatccgcatatgacagtctacgagaacatggccttcggcatg
cagcttgcaggcaaggacaagcagcagtgccgcaagcgggtcgaggcggcggccgaaatg
ctgcagctcacgccctatctcgaacgcctgccgcgccagctttcgggcgggcagcgccag
cgcgtggcgatcggccgggcgatcgttcgcgatcccaaggtctttctgttcgacgagccg
ctttcgaacctcgacgcggcgctgcgtgtggccacgcgcctcgaaatcgccaagcttcac
cgcagcatgcacaagacgacgatgatttatgtgactcacgatcaggttgaggcgatgacg
ctcgccgacaggatatgcgttctgagggacggtctcgtcgagcagatcggcacgccgctg
gagctttacgagacgccgaattcggtgttcgtcgccggcttcatcggttcgccgaagatg
aatttcctttccggcgccttcgcagagccatacaaggcggacacgatcggcatccgcgcg
gaacacctggagatcgatgaacagggaggtgagtggagtgggaccgtgatccattcggag
atgctcggttccgacagctatatttatctcgacatcgggaccggcgagccggtgatcgtc
cgcgagagcggcatcgccaagcatcagcccgggcagacgatcaggatctcgccggccgcc
ggccaggttcaccgcttcgatgcgggtggccgggcgctcggacggatgcaaatgcggggt
gcggcctag

DBGET integrated database retrieval system