KEGG   Sinorhizobium meliloti 1021: SM_b20333
Entry
SM_b20333         CDS       T00058                                 

Symbol
betT
Name
(GenBank) BetT
  KO
K02168  choline/glycine/proline betaine transport protein
Organism
sme  Sinorhizobium meliloti 1021
Brite
KEGG Orthology (KO) [BR:sme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SM_b20333 (betT)
Transporters [BR:sme02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SM_b20333 (betT)
SSDB
Motif
Pfam: BCCT
Other DBs
NCBI-ProteinID: CAC48719
RhizoBase: SM_b20333
UniProt: Q92WM0
Position
pSymB:complement(336729..338849)
AA seq 706 aa
MQNRVVSCRFTGSTARRATMPEGIRGRSHILFLVPLSRAESVGRLHQVQRFKVNLPVFVG
SVAVIALFVGIGVIAPKRAESIFSGMQTAILSGFGWLYLLSVAVFLFSMLFLAFSRYGEL
KLGPDDSEPEFRYLSWIAMLFAAGMGIGLMYFAVGEPMTHFASPPEAEPLTIAAQREAMS
VTFFHWGVHAWAIYSVVGLSLAYFGYRYNLPLTVRSGLYPLLKEGIHGPIGHVVDIFAIC
GTMFGLATSLGFGILQINSGLNYLLGIPQSIYVQLLLVTVVTAIATISVVTGVEKGVRIL
SETNLFLAVLLMLFVLVVGPTGTLMRDFVQNIGLYLDSLVLRTFNIYAYEPRPWIDSWTL
FYWAWWISWSPFVGMFIARISRGRTVREFVTAVLFVPAMFTFLWMTVFGNTAIYVDTTIA
NGELARDVKADLSVALFQFFEYLPWPAVTSTLAVLLVSIFFVTSSDSGSLVIDTIASGGE
TATPALQRIFWCSLSGIVAAVLLSTGGLTALQSATISTALPFSLVMLILVWSLFVGMRAD
LARTQSPGSLGPRAYPASGVPWQRRLAMTLSTPDRRAVEKFLQASVLPALEAVARELTRR
SRPASVGRDAETGALTLTVPAEGHRDFVYGVQMSEHKLPAFTAYDATVADVRYEARTFFS
DGSRGYDIMGMADNQIINDVLFQFERYTGFVRSPESSLLATSPEER
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgcaaaaccgggttgtctcttgtcgattcaccggctcaacggctaggcgtgctactatg
ccggaagggattcgagggagatcgcacatccttttcctagtcccgctctcgcgcgcagaa
tctgtggggaggttgcatcaagtgcagcgtttcaaagtgaatttgccggtattcgtcggt
tcggtggccgtcatcgctctgttcgtcgggataggtgtgattgcgccaaagagagctgaa
tcgattttcagcggaatgcagactgcgatcctgtccgggttcggttggctctacctgctc
tcggtggccgtctttctgttttcgatgctatttctggcgttcagccgctacggcgagttg
aagctcggaccggacgattcagaacccgagttcaggtacctgtcctggatcgccatgctg
tttgccgccggcatgggcattggcctcatgtattttgccgtcggcgagccgatgacgcat
tttgcctcgccgccggaagccgaacccctgaccatcgcggcccagcgcgaggcaatgagc
gtaaccttcttccattggggggtgcacgcctgggcgatatactcggtcgtcgggctgtca
ctcgcctatttcggctaccgctacaatctacccctgaccgtccgatccggcctctacccg
ctcctcaaggagggcattcacgggccgatcggacatgtcgtggatatattcgcgatctgc
gggaccatgttcgggctcgcaacctcgctcggattcggcatccttcagataaactccgga
ctgaactatctgttggggatcccccagtcgatctacgtccagctcctgctcgtgaccgtg
gtcacggcaatagcgactatctcggtggtcaccggcgtcgaaaagggtgtccgcattctc
agcgagaccaatctgttcctggcagtactgctgatgctcttcgtgctcgtggtcgggccg
acgggcacgctcatgcgcgacttcgtccagaacatcggtctctatctcgatagcctggtt
ttgcgaaccttcaacatctatgcctacgagccacggccgtggatcgacagctggaccctg
ttctactgggcatggtggatttcctggtcacccttcgtcggcatgttcatcgcgcgcatt
tcccgtgggcgtaccgtgagagagttcgtcaccgccgtcctcttcgtacccgccatgttc
actttcctctggatgaccgtttttggaaacacggcgatctacgtggacacgacgatcgcc
aacggcgaactggcgcgtgacgtgaaggcggacctttcggtcgcccttttccagttcttc
gagtatctgccgtggcccgcggtaacctcgacgctcgcggttctgctcgtcagcatattc
ttcgtaacctccagcgactccggctcgctggtgatcgacacgattgcatccggcggagaa
acggcgacacccgctcttcagcggattttctggtgttcgctcagcggtatcgtggcggcc
gttctgctctccaccggcggactgacggcactccaatccgccacgatctcgacggcactg
ccgttcagcctcgtgatgctcattctggtgtggtcgctattcgtcggaatgcgggccgat
cttgcccgcacacaatcacccggatcgctcggtccaagagcctatcccgcgtccggtgtg
ccctggcagcggcgcctggcgatgaccttgagcacgccggataggcgggcggtggagaaa
ttcctgcaggcttccgttcttccggcattggaggcagtggcaagggaactgacgcgccgg
tctcggccggcttcagtcggtcgggatgccgaaacgggagcactgaccctcactgttccg
gccgaaggccatcgcgatttcgtctatggcgtgcagatgtcggaacacaaacttcccgcc
ttcaccgcgtatgacgcaaccgtggcagatgtccggtacgaggcgcgcaccttcttttcg
gacggtagccgcggctatgacatcatgggaatggcggacaaccagatcatcaacgatgtt
ctgtttcagttcgaacgatacacgggcttcgtacggtccccggagtcctcgctgttggcg
acctcgcccgaagagcgatag

DBGET integrated database retrieval system