KEGG   Sinorhizobium meliloti 1021: SM_b20535Help
Entry
SM_b20535         CDS       T00058                                 

Definition
(RefSeq) dehydrogenase
Organism
sme  Sinorhizobium meliloti 1021
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh
Motif
Other DBs
NCBI-GeneID: 1236845
NCBI-ProteinID: NP_437054
RhizoBase: SM_b20535
UniProt: Q92W31
Position
pSymB:complement(558359..559369)
Genome map
AA seq 336 aa AA seqDB search
MTLPTVAFAMQPERTRYVLTPELLAQVDAFARILDQRPMTEFADEWSQRLLAEAQILVTG
WGAPFIDAAVLARAPRLRLIVHAAGTIKGLVDESVFDAGIRVSHAAEANAVPVAEFTLAA
VIFAGKQVFRFRDVYAADRGRERTQILQGEAVGNHRRTVGIVGASRIGRRVIGLLRHLDY
RLLLYDPLVKDAEAMALEVEKVDLDTLMARSDIVSLHAPLLPETRHMIDNRQLALMKDGA
TLINTARGALVDEAALIEKLQSGAINAVIDVTDPEIPDENSPLYDLPNVFLTPHIAGAIG
LERMRLGEMAVDEVARFLEGRPLLFEVHKQDLGRMA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcccgaccgtcgcctttgcgatgcagccggaaaggacgcgttatgttttgacg
ccggagcttctcgcgcaggtcgatgccttcgcccgaatcctggatcagcggccgatgacg
gagttcgccgatgagtggtcgcagcgtttgttggccgaggcacaaattttggtgaccggc
tggggcgcgccgttcatcgatgcggccgtcctcgcccgggcgccgcgccttcgcctcatc
gtccatgctgccggcacgatcaaggggctggtcgacgagagcgttttcgatgcggggatc
cgggtcagccacgcggcggaggccaatgccgtaccggtcgccgagtttaccctcgcagcc
gttatttttgcgggcaagcaggtgttccgcttccgcgatgtctatgcggccgaccgtgga
cgcgagcgcacccagatcctgcagggcgaagcggtaggaaaccatcgccgcacggtcggg
atcgtcggcgcatctcggatcggacgccgcgtgatcggactgctgcgccacctcgactat
cgattgctgctttatgatccgttggtcaaagacgccgaagccatggccctcgaggtagag
aaggtcgacctcgatacgttgatggcccgctccgatatcgtgtcgctgcatgcgccgctg
ctacccgagacccggcacatgatcgataaccgccagctcgcccttatgaaggacggcgcg
acgctgatcaacacggcgcgcggcgcgttggtggatgaggcggcactcatcgaaaaactg
cagtcgggcgcgatcaatgccgtgatcgacgttactgaccccgaaattccggacgaaaat
tcaccactttacgacctgccgaacgtatttctgacgccgcatatcgcaggcgccatcggt
ctggagcgcatgcgcctcggtgaaatggcggttgatgaagtggcgcggttcctcgaaggc
aggccgctcctgttcgaggtccacaaacaggatctggggcgcatggcatga

DBGET integrated database retrieval system