KEGG   Sinorhizobium meliloti 1021: SM_b20652Help
Entry
SM_b20652         CDS       T00058                                 

Gene name
asnB
Definition
(RefSeq) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00250  Alanine, aspartate and glutamate metabolism
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SM_b20652 (asnB)
Enzymes [BR:sme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SM_b20652 (asnB)
Peptidases [BR:sme01002]
 Cysteine Peptidases
  Family C44
   SM_b20652 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF1933 DUF3700 QueC
Motif
Other DBs
NCBI-GeneID: 1237692
NCBI-ProteinID: NP_437900
RhizoBase: SM_b20652
UniProt: Q92TY3
Position
pSymB:complement(1453451..1455388)
Genome map
AA seq 645 aa AA seqDB search
MCGFGGYLGSIRDGKPLLERMTAAIGHRGPDERGIFTAPGAGLGHVRLSIVGLGDGQQPM
SNPSGELTIAFNGEIFNYVELRDELRARGRQFRTSSDTEVILHLYEEMGEDCLSLLNGDF
AFAIWDARRRRMMLARDRMGVRPLFHTLKGGTLYFASEVKALLEVPGVSAEIDPIALDQI
FTLWAPIAPRTPFRDIHELEPGHLMIADQNGTTTRPYWQLDYPDRDERPAYAEESRAAEE
LRALLTDATRIRMRADVPVGAYLSGGLDSSIISALAAGMTSQGLRTFSVTFDSAEHDESA
FQEEMAAALGTEHRAVACRAGDIARDFPDVIRFTEKPIIRTAPAPLYKLSGLVREAGLKV
VLTGEGADEVFAGYDIFKEARVRRFCGRQPGSRIRPHLFRKLYPYLPGLQQQSAEYLAAF
FGAGDVALDDPLFSHRPRLKGTAATKMFFSSDLRAELTGYDAAEELVSRLPAAFGRWHPL
HQAQYLESRFLLPGYILSSQGDRMAMAHGIEGRFPFLDHRLVEFAAKLPPEMKLRGLVEK
HILREATKDLLPPAIGRRTKQPYRAPDSHSFSGAGELDYVRSAMSEDAVAAGGLFNAKAV
TKLYEKCQSRPASGFRDNAAFVGVLSTQLWLQTFTGTSLRKAEAA
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattcggcgggtaccttggttcaatacgggacggtaagccccttctcgaaagg
atgacggccgcgatcggccaccgcggcccggacgagcgtgggatcttcaccgcgccgggt
gcgggcctcggtcatgttcggctgtcgattgtggggctcggggacggccagcagccgatg
tccaacccgagcggcgagctgacgatcgccttcaatggcgaaatcttcaactatgtggag
ttgcgcgacgaactgcgcgccagaggccgccagttccgcacctccagcgatacggaggta
atcctccatctttacgaagagatgggcgaggactgtctctctctcctcaacggcgatttc
gccttcgcgatctgggacgcacgccggcgccggatgatgctcgcgcgcgaccgcatgggt
gtgcgcccactcttccacactttgaaaggcggcacgctctatttcgcatccgaggtcaag
gcgctcctcgaagttccgggggtctccgcagagatcgacccgatcgcgctcgaccagata
ttcaccctatgggcgccgatcgcgccgcgtacgcccttccgtgacatccacgagctcgag
cccgggcatctgatgatcgccgatcagaacggcaccacgacaaggccctattggcagctc
gactatccggaccgggacgagcgcccagcctatgcggaggaaagccgcgctgcggaggaa
ttgcgcgcgctcctgacggacgcgacgcggatccgcatgcgggccgatgtgcccgtcggc
gcctatctttccggaggcctcgattcgtccatcatctcggcgctggcggccgggatgacg
tcccaaggcttgcgcaccttctccgtcaccttcgatagcgcggagcatgacgaaagcgca
ttccaggaggagatggcagcggcgctcggaaccgaacaccgcgcggtcgcatgccgcgcc
ggcgacatcgccagggactttcccgatgtcatccgctttaccgagaagccgatcatccgc
actgcgcccgcgccgctctacaaattgtccggcctggtgcgcgaggcgggtctgaaagtg
gtgctgacgggcgagggcgccgacgaggtattcgccggttacgatatcttcaaggaagcg
cgcgtccgccgtttctgcggccggcaacccggctcgcggatcaggccgcatctgttccgc
aagctttacccctatctgccaggcctgcagcagcagtccgccgagtatctcgccgccttt
ttcggcgccggcgacgtggccctcgacgacccgctcttttcgcatcggccacgcctcaag
ggcacggcggcaaccaagatgttcttctcctcggacctgcgcgccgaactcacgggctat
gacgcggcggaagaattggtcagccggctccccgccgccttcggccgctggcatccgctg
catcaggcccaatatctcgaaagccgcttcctgctgcccggatatattctctcgagccag
ggcgaccgcatggcgatggcgcatgggatcgagggccgtttcccgttcctcgaccaccgc
ctcgtcgaattcgccgcaaagctgccgccggaaatgaaactcagagggctcgtcgagaag
cacatcctgcgcgaggcgacgaaagacctgctgccgccggcgatcggccggcggacgaag
cagccctatcgcgctccggacagccactccttcagcggcgcgggcgaactcgattatgtg
cgctccgccatgagcgaggacgcggtcgccgccggcgggctcttcaacgccaaagcggta
acgaaactctacgagaaatgccagtcgcgccccgcctcgggctttcgcgacaacgcggcc
ttcgtcggcgtcctgtcgacgcaactctggctgcagacattcaccggcaccagccttcgc
aaggctgaggccgcgtaa

DBGET integrated database retrieval system