KEGG   Sinorhizobium meliloti 1021: SM_b20950Help
Entry
SM_b20950         CDS       T00058                                 

Gene name
exoT
Definition
(RefSeq) transport protein, Wzx
  KO
K16553  succinoglycan exporter
Organism
sme  Sinorhizobium meliloti 1021
Brite
KEGG Orthology (KO) [BR:sme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SM_b20950 (exoT)
Transporters [BR:sme02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   SM_b20950 (exoT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt Polysacc_synt_3 Polysacc_synt_C
Motif
Other DBs
NCBI-GeneID: 1237405
NCBI-ProteinID: NP_437614
RhizoBase: SM_b20950
UniProt: P33699
Position
pSymB:1177910..1179394
Genome map
AA seq 494 aa AA seqDB search
MTPTVNAKTVTRNVGWSVLSKTGTFGLKFVTVPILARILSPEEFGAVAVALTVVQFLAMI
GGAGLTSALVIQQHEEMETVHSVFWANLAIALMMALGLFVFAEPLATLLGAPEAAYLLRI
MSLLIPLQLGGDVAYSLLVRRMNFRKDAVWSMISESLGAVIAVLLALLGFGIWSLLAQLF
VSALVRLSGLYAVSRYAPRFVFSLQRVLALSRFSFGMMGSEIANFITFQSPMVVISRYLG
LSDAGAYSAANRFASIPNQVVLSAVMGVLFPTFGQMMHDRERRSQALMLSTQVTTVLLAP
MMFGLWALAEPAMLVLFGSQWAYAWPVLGLLALSKGILTPCSTFIPYLKGVGQGAVLFWW
ALIRAVATTGAVAYGAIDGSLVEAMIWLCIVNAVTLVGYSWVVFRADSTPFLKGLFISSR
PMIAALLMALVVRFLLEHFGAHVPNAVLQLIAGTAIGSVIYTVLILLTERSLLRRLLDMA
RARKPRAAPAGAAE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaccccaaccgttaacgcaaaaaccgtaacgcgcaacgtcggctggagcgttctttcc
aagacagggacattcgggcttaaatttgtcacggtgccgattctggcccgcattctgtct
cccgaggaattcggcgccgtcgcggttgcgctcaccgtggtgcagttcctcgccatgatc
ggcggcgccggcctcacctccgcactcgtcatccagcagcatgaggagatggaaaccgtg
cactcggttttctgggcaaacctcgccatcgcgctcatgatggcgctcggactgttcgtt
tttgccgagcccctggccacgctgctcggcgcgccggaggctgcctacctgctaaggatc
atgagtctgctgatcccgctgcagctcggcggcgacgttgcctattcgctgcttgtccgg
aggatgaatttccgcaaggatgccgtctggagcatgatctccgaatcactcggtgccgtt
attgccgttcttctggcgctgctcggtttcggcatatggtcgctgctcgctcagcttttc
gtctccgcgctggtgcgcctgtccggcctctatgccgtttcccgttacgcaccgcgcttc
gtattctcgctgcaacgcgttctggcgctcagccgcttcagtttcggcatgatgggctcc
gagatcgcgaacttcatcaccttccagtccccgatggtggtgatatcccgctatctcggg
ctgtccgacgcaggcgcctattcggcggcgaaccggttcgcgagcatcccgaaccaggtc
gtcctctccgccgtcatgggggtgctgttcccaaccttcggccagatgatgcatgatcgc
gagcggcgttcacaggcgctgatgctcagcactcaggtgaccaccgtcctgctggcgccg
atgatgttcggcctctgggcacttgccgagccggcgatgctcgtacttttcgggagccaa
tgggcctatgcctggccggtcctcggacttctcgcactatcgaaaggcattctcaccccc
tgcagcacgttcatcccctatctcaagggggtcggccagggagccgtcctgttctggtgg
gcgctgattcgcgcggttgcgacaacaggcgcggtcgcctacggtgccatcgacggctcg
ctggtcgaggcgatgatctggctgtgcatcgtcaatgccgtaacgcttgtcggatactcc
tgggtggtgttccgtgccgacagcacgcccttcctcaagggtttgttcatatccagccgg
ccgatgatcgcggcgctgctgatggcgctcgtcgtccgcttcctgctcgagcatttcggc
gcacatgtgccgaacgccgtcttgcaattgatcgccggaacggccatcggcagcgtgatc
tacacggttctgatccttctgacggagcgatcgctgttgcggaggctcctggacatggcg
cgagcacgcaagccgagagccgctcccgcgggagccgccgagtag

DBGET integrated database retrieval system