KEGG   Sinorhizobium meliloti 1021: SM_b20960Help
Entry
SM_b20960         CDS       T00058                                 

Gene name
exoN
Definition
(RefSeq) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00040  Pentose and glucuronate interconversions
sme00052  Galactose metabolism
sme00500  Starch and sucrose metabolism
sme00520  Amino sugar and nucleotide sugar metabolism
sme01100  Metabolic pathways
sme01130  Biosynthesis of antibiotics
Module
sme_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SM_b20960 (exoN)
   00052 Galactose metabolism
    SM_b20960 (exoN)
   00500 Starch and sucrose metabolism
    SM_b20960 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    SM_b20960 (exoN)
Enzymes [BR:sme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SM_b20960 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 1237416
NCBI-ProteinID: NP_437625
RhizoBase: SM_b20960
UniProt: P33696
Position
pSymB:1187438..1188343
Genome map
AA seq 301 aa AA seqDB search
MDRVRTVRKAVIPVAGNGTRFLPATKAVPKEMLTIVDRPVVQYAVDEARQAGIEHIVFVT
SRNKQVIEDHFDDAPELISSLSRSGKSAQISELEAMLPAAGSVSFTRQQAPLGLGHAVWC
ARDLIGDEPFALLLPDMVSFGARGCVAGLMDLYHEVGGNVVGVEQCAPEEASKYGIVGKG
ETVRHGFSVTEMVEKPAAGKAPSNYYLNGRYILQPEIFSILAHQTRGAGNEIQLTDGMLT
LSQSQSFHAHPYEGRTFDCGSKQGFIEANVAFALARADIGDIVFESVRDMVLSHESRIRA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtgtcaggaccgtcagaaaagcagtaatcccggttgccggaaacggaacgagg
ttccttccggcgacgaaggcagtgcccaaggagatgttgacgatcgtcgaccggccagtc
gttcagtatgccgtggacgaggcccgccaggccggaatcgaacatatcgtcttcgtcacc
agccggaacaagcaggtgatcgaggaccatttcgacgacgcgccggagctcatctcgtcg
ctttcacgctccggcaaaagcgcgcagatttccgaactcgaggccatgttgccggcagcc
ggctcggtcagctttacccgtcagcaggcccccctcggcctcgggcacgcggtatggtgt
gcgcgtgacctgatcggcgacgagcccttcgcgcttctgctgccggacatggtctccttc
ggcgcgcgcggttgcgtggccggcctcatggacctctatcacgaggttggcggcaacgtc
gtcggcgtcgagcaatgcgcccccgaggaagcatcgaaatacggcatcgtcggcaagggc
gagacggtccggcacggtttctccgtaaccgagatggtcgaaaagcccgccgccggaaag
gcaccgtccaactactatctcaatggtcgctacatccttcagccggaaatcttctcgatt
ctggcccatcagacacgcggcgccggcaatgagatccagttgaccgatggcatgctgacg
ctttcgcaatcccagtccttccacgcgcatccctatgaaggccgcaccttcgactgcggc
tcgaagcagggcttcatcgaagccaatgtcgccttcgcccttgctcgtgcggacatcggc
gatatcgttttcgaatccgtccgcgacatggttctgtctcacgaaagccgcatccgggcg
gcataa

DBGET integrated database retrieval system