KEGG   Sinorhizobium meliloti 1021: SM_b20987Help
Entry
SM_b20987         CDS       T00058                                 

Definition
(RefSeq) siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00860  Porphyrin and chlorophyll metabolism
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SM_b20987
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     SM_b20987
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     SM_b20987
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     SM_b20987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M
Motif
Other DBs
NCBI-GeneID: 1237443
NCBI-ProteinID: NP_437652
RhizoBase: SM_b20987
UniProt: Q92UL5
Position
pSymB:1220792..1221874
Genome map
AA seq 360 aa AA seqDB search
MTALATLPLFWPLNGKQAVVAGGSDAAAWKAELLAACGAEVHVYAPRASLSDVFLDLLAR
GPAHEHGRLIHHDQAWHVGDFRDAAIAVADCDEQSDAEAFFLAGRSAGVPVNVIDKPAFC
AFQFGSIVNRSPVVVAISTDGAAPILAQAIRRRIEALLPPALKHWATVAQAIRDRVNARL
KPGSARRAFWERFVDRVFLDAPEEGVETRLMAEVDRLVTRPSAIGRVTIVGAGPGDAELL
TLKAVRALQAADVILFDEWIPDDVLELARREARRVPVTPSAKGRSRDIAALVGEGKRVVR
LRSGNPMALAGAVEEIAALEGLGVPVEIVPGVEAAPCRSDVIQVVFRRREVSQPGLRAAH
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcactcgcgacgctgccgctcttctggcccctgaacggcaaacaggccgtcgtc
gccggcggcagcgatgcggccgcgtggaaggcagagctgctggcggcctgcggcgcggaa
gttcacgtctacgcgccacgtgcgtcgctgagcgatgtcttcctagacctcctcgcccgt
gggcccgcgcatgagcacggccggctcattcaccacgaccaggcgtggcatgtgggtgat
tttcgcgacgcggcaatcgccgttgccgattgcgacgagcaatccgatgcagaagcattc
ttcctggccgggcggagcgccggcgtgcccgtcaacgtcatcgacaaaccggccttctgt
gcgttccagttcggatcgatcgtgaaccgctcgcccgtggtcgtcgcgatctcgaccgac
ggggcggcaccgatcctggcacaggcgatccgccggcggatcgaagccctgctgccgccg
gcactcaaacattgggcgacggtggcgcaggcgatccgcgaccgcgtgaacgcgcgcctg
aaacccggttccgcgcgccgcgccttctgggagcgcttcgtcgaccgggtctttctggat
gcaccggaggagggtgtagagacgcggctgatggcggaggtggatcgtctggtcacgcgc
ccctccgccatcggccgcgtcaccatcgtcggcgccggacccggcgacgcggaactcctc
accttgaaggcggttcgcgccttgcaagccgccgacgtgatcctctttgacgaatggatc
cccgacgacgtcctggaactggcgcgcagggaggcaaggcgcgtccccgtcacgccgagc
gccaagggtcgaagcagagacatcgcggcccttgtcggggaagggaagcgcgttgtgcgc
cttcgatccgggaacccgatggcgcttgccggtgccgtcgaggagatcgcagcgcttgaa
ggccttggagttcctgtcgagatcgtgccgggtgtcgaggcggcaccttgccgttccgac
gtgatccaggtggtcttccgccggagggaggtctcgcaaccgggcctgcgcgctgcccat
tga

DBGET integrated database retrieval system