KEGG   Sinorhizobium meliloti 1021: SM_b21010Help
Entry
SM_b21010         CDS       T00058                                 

Gene name
bdhA
Definition
(RefSeq) D-beta-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00072  Synthesis and degradation of ketone bodies
sme00650  Butanoate metabolism
sme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SM_b21010 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    SM_b21010 (bdhA)
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     SM_b21010 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-GeneID: 1237467
NCBI-ProteinID: NP_437676
RhizoBase: SM_b21010
UniProt: O86034
Structure
PDB: 

Position
pSymB:1244108..1244884
Genome map
AA seq 258 aa AA seqDB search
MTKTAVITGSTSGIGLAIARTLAKAGANIVLNGFGAPDEIRTVTDEVAGLSSGTVLHHPA
DMTKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTI
RGAIPPMKKKGWGRIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNS
ICPGYVLTPLVEKQIPDQARTRGITEEQVINEVMLKGQPTKKFITVEQVASLALYLAGDD
AAQITGTHVSMDGGWTAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagactgcggtgataacgggttccacgagcggcatcggattggcgatcgcccgg
accctggcgaaggccggtgccaatatcgtcctgaacggcttcggtgcgccggacgagatc
aggaccgtcacggatgaagtcgcaggcctgagctccggtacggtgcttcatcacccggcc
gacatgaccaagccctccgaaatcgccgacatgatggcgatggttgccgatcgcttcggc
ggcgccgatatcctcgtcaacaatgccggcgtgcagttcgttgaaaagatcgaggatttt
ccggtcgagcaatgggaccggatcatcgccgtcaatctctcctcctcctttcacaccatt
cgtggcgccattccgccgatgaagaagaagggctggggccggatcatcaatatcgcgtcc
gctcatggcctcgtggcctcccccttcaagtccgcctatgtcgccgccaagcatggtatc
atggggttgacgaagactgtggcgctggaggtggcggagagcggtgtcaccgtgaactcg
atctgccccggctacgttctgacgccgctcgtcgaaaagcagataccggatcaggcgaga
acgcgcggcatcaccgaggaacaggtgatcaacgaggtgatgctcaagggacagccgacg
aaaaagttcatcaccgtcgaacaggttgcctccctggcgctctatcttgcaggcgacgat
gccgcccagatcaccgggacgcatgtttcgatggatggcggctggacggcgcagtag

DBGET integrated database retrieval system