KEGG   Sinorhizobium meliloti 1021: SM_b21081Help
Entry
SM_b21081         CDS       T00058                                 

Gene name
manB
Definition
(RefSeq) phosphoglucomutase phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00010  Glycolysis / Gluconeogenesis
sme00030  Pentose phosphate pathway
sme00051  Fructose and mannose metabolism
sme00052  Galactose metabolism
sme00230  Purine metabolism
sme00500  Starch and sucrose metabolism
sme00520  Amino sugar and nucleotide sugar metabolism
sme00521  Streptomycin biosynthesis
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
sme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SM_b21081 (manB)
   00030 Pentose phosphate pathway
    SM_b21081 (manB)
   00051 Fructose and mannose metabolism
    SM_b21081 (manB)
   00052 Galactose metabolism
    SM_b21081 (manB)
   00500 Starch and sucrose metabolism
    SM_b21081 (manB)
   00520 Amino sugar and nucleotide sugar metabolism
    SM_b21081 (manB)
  Nucleotide metabolism
   00230 Purine metabolism
    SM_b21081 (manB)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SM_b21081 (manB)
Enzymes [BR:sme01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     SM_b21081 (manB)
    5.4.2.8  phosphomannomutase
     SM_b21081 (manB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 1236991
NCBI-ProteinID: NP_437200
RhizoBase: SM_b21081
UniProt: Q92VN9
Position
pSymB:718406..719953
Genome map
AA seq 515 aa AA seqDB search
MNFARFEPASANGPAQESGPEKFTYETSPLIRATGFREYDARWWFGRSDCGKAPELNLMG
AQALGMGLGTFIQRSGAGPEIVTGHDFRSYSLGIKLALVCGLMAAGARVRDIGLALSPMA
YFAQFALDVPSVAMVTASHNENGWTGVKMGMARPLTFGPQEMAELRRIVLEADFDLTGGG
AYEFVPDFRRRYIDDLTRGRRIGRKLKVVAACGNGTAGAFAPDVLQRIGCEVIPLDCDLD
HSFPRYNPNPEDLKMLHAIRDKVLESGADVGLGFDGDGDRCGVVDNEGSEIFADKIGVML
ARDISASNPGSVFVVDVKSTGLFASDPVLKANGARTDYWKTGHSYIKRRVAELGAIAGFE
KSGHFFFNAPLGRGYDDGLITAISICEMLDRSPNRSIAEIYRALPMTWSSPTMSPHCADE
VKYAVAERVVERFRAMQRDGVPVAGQMIADLVTVNGVRVVTEDGTWGLVRASSNKPELVV
VVESPVSEARQRAMFEAVDCVLRENPEVGAYNQTI
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgctcgttttgaaccggcgtcggcaaatgggccggcccaagaatccggaccc
gagaaatttacctatgagacgagcccgctgatacgggcgaccgggtttcgggaatacgat
gcgcggtggtggttcgggcgctccgattgcgggaaggcgccggaacttaacctgatgggc
gctcaggcactgggcatggggctcggcaccttcatccagcgctcgggcgccggtccggag
atcgtgaccgggcacgacttccgttcctactcgcttggcatcaagctggcattggtttgc
gggctgatggccgcaggcgcccgggtcagggacatcggcttggctttgtctccgatggcc
tatttcgcgcagttcgcactcgatgtcccgtcggtcgcgatggtgacggcctcgcacaac
gagaacgggtggaccggcgtcaagatgggcatggcccggccgctgaccttcgggccgcaa
gagatggcggagttgagaaggatcgtactggaagctgacttcgacctgaccggcggcgga
gcctatgagtttgttcccgacttccgtcggcgctatatcgacgatctgacccgcggcagg
cgcattggccggaagctgaaggtcgttgccgcctgcggcaacggcacagccggcgctttt
gcgcctgatgtgctgcagcggatcggctgcgaggtgatcccgctcgactgcgatctggac
cattccttcccccgctataatcccaatcccgaggacctgaagatgctccatgccatccgg
gacaaggtcttggagagcggtgccgatgtcgggctgggcttcgacggcgatggcgatcgc
tgcggggtggtcgacaacgagggcagcgagatcttcgccgacaagatcggtgtgatgttg
gcacgggatatttccgcttcgaatcctggttcggttttcgtggtcgacgtcaaatcgaca
gggcttttcgcgagcgatccggtgctgaaggcgaacggtgcgcgcaccgactactggaag
accggccattcctatatcaaacgaagggtcgctgaattgggtgccattgcgggcttcgag
aagtcggggcacttcttcttcaatgcgcctctcgggcgcgggtatgacgatgggttgatc
accgcgatctcgatctgtgagatgctcgaccgcagtccgaacagaagcatcgccgagatc
taccgggcgctgccgatgacctggagctcaccaaccatgtcgccacattgcgccgatgaa
gtgaagtatgccgtggctgaacgggtggtggagcggttccgggcgatgcagcgggacgga
gttcctgtcgcaggacagatgattgccgatctcgtcaccgtcaacggcgtgcgcgtggtg
accgaggacggcacctggggactggtgcgggcatcctccaacaagccggagcttgtcgtc
gtggtcgaaagcccggtctcggaagcacgccagcgcgccatgttcgaggcggtcgactgc
gtactcagggaaaatccggaggtcggcgcctacaaccagaccatctag

DBGET integrated database retrieval system