KEGG   Sinorhizobium meliloti 1021: SM_b21301Help
Entry
SM_b21301         CDS       T00058                                 

Definition
(RefSeq) ly membrane-anchored aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00010  Glycolysis / Gluconeogenesis
sme00053  Ascorbate and aldarate metabolism
sme00071  Fatty acid degradation
sme00280  Valine, leucine and isoleucine degradation
sme00310  Lysine degradation
sme00330  Arginine and proline metabolism
sme00340  Histidine metabolism
sme00380  Tryptophan metabolism
sme00410  beta-Alanine metabolism
sme00561  Glycerolipid metabolism
sme00620  Pyruvate metabolism
sme00625  Chloroalkane and chloroalkene degradation
sme00903  Limonene and pinene degradation
sme01100  Metabolic pathways
sme01110  Biosynthesis of secondary metabolites
sme01120  Microbial metabolism in diverse environments
sme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SM_b21301
   00053 Ascorbate and aldarate metabolism
    SM_b21301
   00620 Pyruvate metabolism
    SM_b21301
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SM_b21301
   00561 Glycerolipid metabolism
    SM_b21301
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SM_b21301
   00310 Lysine degradation
    SM_b21301
   00330 Arginine and proline metabolism
    SM_b21301
   00340 Histidine metabolism
    SM_b21301
   00380 Tryptophan metabolism
    SM_b21301
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SM_b21301
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SM_b21301
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SM_b21301
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SM_b21301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-GeneID: 1237136
NCBI-ProteinID: NP_437345
RhizoBase: SM_b21301
UniProt: Q92VA3
Position
pSymB:882510..884894
Genome map
AA seq 794 aa AA seqDB search
MSVATFFDEMSYGPAPEADTEARAWLTRHEGKLGHFINGAFVGSASGKSFDTFEPATGKL
LAKIAHGGRDDVNAAVAAARKAQGPWAKLSGHARARHLYALARLIQRHARLIAVVEALDN
GKPIRETRDIDIPLAARHFYHHAGWAQLQETEFADQVPVGVVGQVIPWNFPFLMLAWKVA
PALALGNSVILKPAEFTPLTALLFAELAAAAGLPPGVLNVVTGEGETGALIVEHEDIDKI
AFTGSTEVGRLIREKTAGSGKSLTLELGGKSPFIVFDDADIDAAVEGVVDAIWFNQGQVC
CAGSRLLVQEGVAPVFHDRLKRRMETLRVGHPLDKAIDMAAIVAPVQLQRIEELVAKGVA
EGASMHQPKIELPKGGSFFRPTLLTGVQPTSVVATEEIFGPVAVSMTFRTPEEAIQLANH
SRYGLAASVWSETIGLALHVAAKLAAGVVWVNATNLFDASSGFGGKRESGFGREGGREGC
YEYLKPKAWMGRKLRPEHGLPAPKQAAGDFAVPALDRTAKLFVGGKQARPDGNYSRPVLS
PKGKVIGEVGEGNRKDIRNAVVAARGASGWSSATAHNRAQILYYIAENLSSRGAEFAGRI
AAMTGASAANARAEVEASIARLFSYGAWADKYEGTVHQPPLRGVALAMPEPQGVVGVICP
PEAPLLGLVSLVAPLIAVGNRVVAVPSEAHPLAATDFYSVLETSDVPPGVINIVTGSAIE
LAKALAAHNDVDALWAFGSPELSTLVEKLSVGNLKRTFVDYGKAIDWTDRSAAEGQAFLR
RAVDVKNIWIPYGE
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttgccactttcttcgacgaaatgtcctatggcccggcccccgaagccgatacc
gaggcgcgcgcctggctcactcggcatgaaggcaagctcggccacttcataaacggcgca
ttcgtcggttcagcatcaggcaaatccttcgacacgttcgagcccgcaacgggcaaattg
ctcgcgaaaatcgcacatggcgggcgcgacgacgtgaacgcggcggtggcggcagcgcgc
aaggcgcagggcccgtgggcaaagctctccggacatgcccgcgcccggcacctctatgcg
ctcgcgcgcctgattcagcgccatgcgcgcctgatcgccgtcgtcgaagcgctcgacaac
ggcaagccgatccgggaaacgcgcgacatcgacataccgcttgccgctcgccatttctat
catcatgccggctgggcacagctgcaggagacggaattcgccgaccaggtgcccgtgggc
gttgtcggacaggtcatcccctggaacttccccttcctgatgctcgcctggaaggttgcg
ccggcgctggcgctcggcaattccgtcatcctgaagcctgcggagtttacgcccttgacg
gcgctgctcttcgcggagcttgccgctgcagcgggtctccccccgggcgtgctgaacgtg
gtgacgggcgagggcgagacgggggcgctgatcgtcgagcacgaggatatcgacaagatc
gcctttaccggctcgaccgaagtcggacgcctcatccgcgagaagacagcggggagcggc
aagtcgctgacgctggagcttggcggcaagtcgcccttcatcgtctttgacgatgccgat
atcgacgcggcggtcgaaggcgtcgtggatgcgatctggttcaatcagggccaggtctgc
tgcgccggttcacgccttctggtgcaggagggcgtggcgccggtctttcatgaccggttg
aagcggcgcatggagacgctccgcgtcggtcatccgctcgacaaggcgatcgatatggcg
gcgatcgtcgcgccggtgcagttgcagcgaatcgaagagctggtggcgaagggcgtcgcc
gaaggcgcatcgatgcatcagccgaagatcgaactcccgaagggcggcagcttctttcgg
ccgacgctgttgaccggcgtccagccgacttccgtcgtcgcgaccgaggaaatcttcggg
ccggtggccgtatcgatgaccttccgtacgccggaggaggcgatccagcttgcaaatcat
agccgctacggccttgccgcgagcgtctggagcgaaacgatcggtcttgccctgcatgtt
gccgcaaagcttgcggccggtgtcgtctgggtcaatgcgaccaacctcttcgatgcgtcg
agcggcttcggcggaaagcgcgaatccggcttcggccgtgagggcgggcgagagggctgc
tacgaatatctgaagccgaaggcctggatggggcgcaagctgcgccccgaacacggcttg
ccggccccgaagcaggccgccggtgatttcgccgttccggcgctcgatcgcactgccaag
ctcttcgtcggcggcaagcaggcgcggccggacgggaactattcgcggcccgtgctttcc
ccgaaaggcaaggtgatcggcgaagtcggcgagggcaaccgcaaggatatccgcaatgcc
gtcgttgcggcgcggggcgcctcgggctggtcttcggcaacagcgcataaccgcgcccag
atcctctattacatcgccgagaatctgagcagccgcggggcggaattcgccggccgcatc
gccgccatgacgggggcctcggcagccaatgcccgagcggaggtcgaagcttcgattgcc
cggctgttcagctacggagcctgggcggacaaatacgagggcaccgtgcaccagccgccc
ctgcgcggcgtggcactggccatgccggaaccccagggcgtcgtcggcgtcatctgcccc
ccggaagcgccgctgctcgggcttgtcagtctcgtggcaccgctgattgcagtcggaaac
cgggtggtcgccgtgccgagcgaagcgcatcctctggctgcgaccgacttctattcggtc
ctcgagacctcggatgtgccgcccggcgtcatcaatatcgtcaccggatctgcgatcgaa
ctcgccaaggcactcgccgcgcacaacgacgtggacgcgctctgggcgttcggctcgccg
gaactttcgacactcgtcgagaagctgtccgtcggcaacctcaagcgtaccttcgtggat
tacggcaaggcgatcgattggacggatcgctcggccgccgaaggacaggcgttcctgcgg
cgagcggtcgatgtcaagaacatctggattccctatggcgaatag

DBGET integrated database retrieval system