KEGG   Sinorhizobium meliloti 1021: SM_b21647
Entry
SM_b21647         CDS       T00058                                 

Symbol
agpA
Name
(GenBank) periplasmic alpha-galactoside binding protein
  KO
K25096  alpha-galactoside transport system substrate-binding protein
Organism
sme  Sinorhizobium meliloti 1021
Brite
KEGG Orthology (KO) [BR:sme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SM_b21647 (agpA)
Transporters [BR:sme02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Alpha-galactoside transporter
    SM_b21647 (agpA)
SSDB
Motif
Pfam: SBP_bac_5
Other DBs
NCBI-ProteinID: CAC49966
RhizoBase: SM_b21647
UniProt: Q9X4Y1
Position
pSymB:complement(1676356..1678437)
AA seq 693 aa
MKTHRLNMTASLLIGISAFAVQAFASEPTVVPEQPPFPAQGKITYVSRDSILEFKALREY
REPEWVTEKFVKAGKLPPVAERLPKEPMVFKAGNMPDGMGVYGDVMRHVIGGRPEGWNYS
AGQTQGWGGIDIGMFECLTRTAPLFQVEADDMEPLPNLAKSWDWSEDGRKLTMHLIEGAK
WSDGDPFDADDVMFYWEDNVLDSSVSPLNGATPETFGEGTTLKKIDQYTVEWTFKEAFPR
QHLFAMAYGTFCPGPSHILKTKHPKYAGTTYNEYKNGFPAEYMNLPVMGAWVPVAYRPDD
IIVLRRNPYYWKVDEAGNQLPYLNELHYKLSTWADRDVQAIAGSGDISNLEQPENFVESL
KRAANESAPARLAFGPRVIGYNMHMNFSGNGWGDPDERAKAVRELNRNLDFRKAVTMAVD
RKKLGEALVKGPFTAIYPGGLSSGTSFYDRNSTIYYPHDLEGAKVLLEKVGLKDTDGNGF
VNFPAGKLGGRDVEIVLLVNSDYSTDRNLAEGMVGQMEKLGLRVVLNALDGKQRDAANYA
GRFDWMIHRNTAEFASVVQNTPQLAPTGPRTSWHHRAPEGGEVDVMPHEQELVDIVNKFI
ASNDNDERTELMKQYQKVATTNVDTVGLTEYPGALIINKRFSNIPPGAPIFMFNWAEDTI
IRERVFVAADKQGDYELYPEQLPGKPGESGPIN
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgaaaacgcatcgactgaatatgaccgcgagcctgctgatcggcatatctgcctttgcc
gtgcaggccttcgcatccgagccgaccgtggtgcccgagcagccgccctttccggcacag
ggcaaaatcacctatgtgtcgcgcgattccattctcgagttcaaggcgctgcgcgaatac
agggagcccgaatgggtcacggagaaattcgtcaaggccggcaagctgccgccggtggcc
gagcggcttccgaaggagccgatggttttcaaggccggcaacatgccggacggcatgggc
gtctatggcgatgtcatgcgccacgtcatcggtggccggccggaaggctggaactacagc
gccggccagactcaaggatggggcggcatcgacatcggcatgttcgagtgcctgacgcgc
accgcgccgctcttccaggtcgaggccgacgatatggagccgctgccgaatctggcgaaa
agctgggactggtcggaggacggccgcaagctgaccatgcatctgatcgagggcgcgaaa
tggtcggacggcgatcccttcgacgccgatgacgtcatgttctactgggaggacaatgtc
ctcgactcgagcgtttcgccgttgaacggcgcgacgcccgaaaccttcggcgagggcacg
acgctcaagaagatcgaccagtatacggtcgaatggaccttcaaggaggccttcccgcgc
cagcatcttttcgcaatggcctacggtaccttctgccccggcccgtcgcatatcctcaag
accaagcatccgaaatatgccggcacgacctataacgaatacaagaacggcttccccgcc
gaatatatgaaccttccggtgatgggtgcatgggtgccggtcgcctatcgtcctgacgac
atcatcgtgctgcgccgcaatccttattactggaaggtcgacgaggccggcaatcagttg
ccctacctcaacgagctccactacaagctctcgacctgggccgaccgcgacgtgcaggcg
atcgcgggttcgggcgatatctcgaacctcgaacagccggaaaacttcgtggagtcgctg
aagcgcgccgccaatgagagcgccccggcgcggctcgccttcggcccgcgcgtcatcggc
tacaacatgcacatgaacttctccggcaatggctggggagacccggacgaacgcgcgaag
gcggtgcgggagctcaaccgcaatctggacttccgtaaggccgtcaccatggcggtcgac
cgcaagaagcttggggaggctctggtgaagggccccttcacggcgatctatccgggcggg
ctttcctccggcacgagcttctacgaccggaactccaccatctactacccccacgatctc
gaaggcgccaaggtgcttctcgaaaaggtggggctcaaagacacggacggcaacggcttc
gtcaatttcccggccggcaagcttggcggccgcgacgtcgaaatcgtgctgctcgtcaat
tccgactacagcaccgaccgtaatcttgccgaaggcatggtcgggcagatggagaagctc
gggctccgggtcgtcctcaatgcgctcgacggcaagcagcgcgacgccgccaattatgcc
ggccgcttcgactggatgattcatcgcaacacggcggaatttgcatccgtggtgcagaat
acgcctcagctcgccccgaccggcccgcgcaccagctggcatcaccgcgctccggaaggc
ggtgaagtcgatgtcatgccccacgagcaggagctcgtcgacatcgtcaacaagttcatc
gccagcaacgacaatgacgagcgaacggagctgatgaagcagtaccagaaggtggccacc
accaatgtcgataccgtcggcctgacggagtatccgggcgcgctgatcatcaacaagcgc
ttctcgaacattcctcctggcgcgccgatcttcatgttcaactgggcggaagacacgatc
atccgcgaacgggtcttcgttgccgccgacaagcagggcgactacgaactctatcccgag
cagcttcccggcaagcccggcgaaagcggcccgatcaattga

DBGET integrated database retrieval system